Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.26
PubTator Score 6.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (3)

PMID Text
23096689 Two alternative splice variants of ODF3 and ODF4, were found.
22588436 ODF4 is a cancer-testis (CT) gene useful for detection of CML. It was expressed in 30% of CML patients but not in any of the healthy donors.
12728016 Genomic structure has evolved independently of mouse, whereas functional structure is well-conserved

AA Sequence

MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQRQNSPLPFQW      1 - 70
RITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDVSNRIHTSAHVMSMGLLHFYK     71 - 140
SRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIGWSYFIGWLVLILYFTCAILCYFNHKSFWSL    141 - 210
ILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQKDTHV                           211 - 257
//

Text Mined References (6)

PMID Year Title
23096689 2012 Expression of splice variants of cancer-testis genes ODF3 and ODF4 in the testis of a prostate cancer patient.
22588436 Expression of testis-specific genes, TEX101 and ODF4, in chronic myeloid leukemia and evaluation of TEX101 immunogenicity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15270212 2004 Isolation and expression analysis of the testis-specific gene, human OPPO1.
12728016 2003 Molecular cloning and characterization of the human orthologue of the oppo 1 gene encoding a sperm tail protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.