Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.25
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Synonym

Accession Q2M243 Q5TBV3 Q96M50
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18597038 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFEAIFPSTPQARLKRDPREKPGLSSFRSTFRQQSSLGLCIPRLMLPKEASPSQRHSSMSSSMARALVLL      1 - 70
QSMASRDARCPEWKPHQKPRTLSKSVQTISRYYRKTSEPKDAASLTGFMSKMELRRVFPTHPDCPQFSTR     71 - 140
ATSMSHCGSPTEADLSGEIDNSSETWRGTQDLFLARRGSDTNVDGYLLPFSKSICEFDYLRKRRKSQTLS    141 - 210
PVTSSSVASQSCLRKRMPWYLSVIHEKDHCLSELEIQVQKKDEEILLLQEEREALKMQLKCLLKGKGQET    211 - 280
SMSPGRREQLSDASLKLGRLSLLKAFSRHEEELQHWWQMQEESAAPERGKEPDLGGGEEDEGLEGEPDGV    281 - 350
EDTGAWGGVSQMGSVHEEGSEEEEEEEGDRDEDSEERELPEEEEIPRRRASSLAESFEEELLAQLEEYEQ    351 - 420
VILDFQFNLEATRTRYSLATGVIASLQQQVDFQETQLRKINTENETLQKELRERRQQLQAMTDKFSNLRE    421 - 490
DKKHQEMMGLIEKDNQLLRQQVSELERKLTKRDCVISELDTKVSQLQEQVELDQNHLQRWKQLQEDLQSK    491 - 560
KEMIQQAEQHTRVALESSQSRLERLRNKIIQATFSISGTKSLANEISDNDILEALQRIISERSDYYNQLK    561 - 630
QKGVKVPPLQQSEAFLTSKSKKGTSK                                                631 - 656
//

Text Mined References (10)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18597038 2009 High resolution linkage and linkage disequilibrium analyses of chromosome 1p36 SNPs identify new positional candidate genes for low bone mineral density.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.