Property Summary

NCBI Gene PubMed Count 4
Grant Count 8
R01 Count 8
Funding $502,455.65
PubMed Score 46.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

AA Sequence

MGFAEAFLEHLWKNLQDPSNPAIIRQAAGNYIGSFLARAKFISLITVKPCLDLLVNWLHIYLNNQDSGTK      1 - 70
AFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYPQSLNFERIVMSQLNPLKICLPSVVNFFAA     71 - 140
ITKMKTCGYGWW                                                              141 - 152
//

Text Mined References (6)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.