Property Summary

NCBI Gene PubMed Count 4
PubMed Score 49.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.5e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Synonym

Accession Q2M238 A8K6T4 B3KWX9 O75704
Symbols

Gene

PANTHER Protein Class (1)

AA Sequence

MGFAEAFLEHLWKNLQDPSNPAIIRQAAGNYIGSFLARAKFISLITVKPCLDLLVNWLHIYLNNQDSGTK      1 - 70
AFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYPQSLNFERIVMSQLNPLKICLPSVVNFFAA     71 - 140
ITKMKTCGYGWW                                                              141 - 152
//

Text Mined References (6)

PMID Year Title