Property Summary

NCBI Gene PubMed Count 4
Grant Count 23
R01 Count 13
Funding $1,567,597.52
PubMed Score 35.14
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
23393141 Genetics and diet regulate vitamin A production via the homeobox transcription factor ISX
23221382 our results highlight ISX as an important regulator in hepatoma progression with significant potential as a prognostic and therapeutic target in HCCs.

AA Sequence

MCAEVGPALCRGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKP      1 - 70
PKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARINLPEARVQIWFQNQRAKWRKQ     71 - 140
EKIGNLGAPQQLSEASVALPTNLDVAGPTWTSTALRRLAPPTSCCPSAQDQLASAWFPAWITLLPAHPWE    141 - 210
TQPVPGLPIHQTCIPVLCILPPPHPKWGSICATST                                       211 - 245
//

Text Mined References (7)

PMID Year Title
23393141 2013 Genetics and diet regulate vitamin A production via the homeobox transcription factor ISX.
23221382 2013 Proinflammatory homeobox gene, ISX, regulates tumor growth and survival in hepatocellular carcinoma.
18093975 2008 Isx participates in the maintenance of vitamin A metabolism by regulation of beta-carotene 15,15'-monooxygenase (Bcmo1) expression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.