Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.88
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Parkinson Disease 105
Disease Target Count P-value
psoriasis 6685 4.82993733140297E-56
Disease Target Count Z-score Confidence
Parkinson's disease 364 0.0 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 0.000

Synonym

Accession Q2L4Q9
Symbols POL3S
UNQ308

Gene

PANTHER Protein Class (3)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
16566820 Comparative analysis of polyserase-3 with the two human polyserases described to date, revealed that this novel polyprotein is more closely related to polyserase-2 than to polyserase-1.

AA Sequence

MKWCWGPVLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHICSGSLVADT      1 - 70
WVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQLAHPTTH     71 - 140
TPLCLPQPAHRFPFGASCWATGWDQDTSDAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCG    141 - 210
GPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWLQARVQGAAFLAQ    211 - 280
SPETPEMSDEDSCVACGSLRTAGPQAGAPSPWPWEARLMHQGQLACGGALVSEEAVLTAAHCFIGRQAPE    281 - 350
EWSVGLGTRPEEWGLKQLILHGAYTHPEGGYDMALLLLAQPVTLGASLRPLCLPYPDHHLPDGERGWVLG    351 - 420
RARPGAGISSLQTVPVTLLGPRACSRLHAAPGGDGSPILPGMVCTSAVGELPSCEGLSGAPLVHEVRGTW    421 - 490
FLAGLHSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEPGSCLANISQPTSC           491 - 553
//

Text Mined References (4)

PMID Year Title
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
16566820 2006 Identification and characterization of human polyserase-3, a novel protein with tandem serine-protease domains in the same polypeptide chain.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.