Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.88
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 0.000

Gene RIF (1)

PMID Text
16566820 Comparative analysis of polyserase-3 with the two human polyserases described to date, revealed that this novel polyprotein is more closely related to polyserase-2 than to polyserase-1.

AA Sequence

MKWCWGPVLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHICSGSLVADT      1 - 70
WVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQLAHPTTH     71 - 140
TPLCLPQPAHRFPFGASCWATGWDQDTSDAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCG    141 - 210
GPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWLQARVQGAAFLAQ    211 - 280
SPETPEMSDEDSCVACGSLRTAGPQAGAPSPWPWEARLMHQGQLACGGALVSEEAVLTAAHCFIGRQAPE    281 - 350
EWSVGLGTRPEEWGLKQLILHGAYTHPEGGYDMALLLLAQPVTLGASLRPLCLPYPDHHLPDGERGWVLG    351 - 420
RARPGAGISSLQTVPVTLLGPRACSRLHAAPGGDGSPILPGMVCTSAVGELPSCEGLSGAPLVHEVRGTW    421 - 490
FLAGLHSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEPGSCLANISQPTSC           491 - 553
//

Text Mined References (4)

PMID Year Title
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
16566820 2006 Identification and characterization of human polyserase-3, a novel protein with tandem serine-protease domains in the same polypeptide chain.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.