Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 1.4e-02
atypical teratoid / rhabdoid tumor -1.100 1.2e-02
ependymoma -1.200 1.4e-05
glioblastoma -1.200 1.1e-04
medulloblastoma, large-cell 3.200 2.2e-02
pediatric high grade glioma -1.100 1.6e-02

Gene RIF (1)

AA Sequence

MAKMELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTN      1 - 70
TSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPALLHPQSWKQFRALRSSGTAAAKGERCRSFIE     71 - 140
LTPPAKREILWLSLGTQITYIGLQFISFLLLLTDLLLTGNPACGLKLSAFAAVSSVLSGLLGMVAHMMYS    141 - 210
QVFQATVNLGPEDWRPHVWNYGWAFYMAWLSFTCCMASAVTTFNTYTRMVLEFKCKHSKSFKENPNCLPH    211 - 280
HHQCFPRRLSSAAPTVGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVEEEQC     281 - 349
//

Text Mined References (12)

PMID Year Title