Property Summary

NCBI Gene PubMed Count 76
Grant Count 8
R01 Count 2
Funding $1,242,317.06
PubMed Score 38.47
PubTator Score 46.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.001
osteosarcoma -1.899 0.000

Gene RIF (63)

PMID Text
26203907 A possible regulatory role for the multiple sclerosis-associated rs12927355 in CLEC16A.
26121298 CLEC16A was found to be a susceptibility factor for SLE, with possible contribution to the development of the disease.
25903733 This study demonstrated that the Polymorphism, Single Nucleotide of CLEC16A is associated with multiple sclerosis in Russia.
25891430 Clec16a knockdown mice showed reduced number of B cells and elevated IgM levels compared with controls.
25823473 identify CLEC16A as a pivotal gene in multiple sclerosis that serves as a direct regulator of the human leukocyte antigen class II pathway in antigen-presenting cells.
25576669 The study suggested that a CLEC16A polymorphism may be protective against Vogt-Koyanagi-Harada syndrome syndrome in a Chinese Han population.
25447402 data suggests that two polymorphisms of the CLEC16A gene play an important role in the developing of ACS in men.
25008175 Forty-eight SNPs, all located in CLEC16A, provided a statistically significant association with type 1 diabetes mellitus, with rs34306440 being most significantly associated. The mechanisim is likely through reduced expression of DEXI transcripts.
24949970 Study demonstrates that a diabetogenic SNP in the CLEC16A locus correlates with islet CLEC16A expression, beta cell function, and glycemic control in human subjects. Clec16a controls beta cell function and prevents diabetes by controlling mitophagy.
24646814 Our results suggest that polymorphisms rs6498169 of CLEC16A gene confers susceptibility to AITDs. We therefore disclose for the first time the association of rs6498169 SNP with AITDs.
More...

AA Sequence

MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIWGDQNDSSVFD      1 - 70
FFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMA     71 - 140
YYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFNHPESMVRIAVRTITLNVYKVSLDNQAMLHY    141 - 210
IRDKTAVPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLT    211 - 280
DHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTE    281 - 350
QDIQRSSAKPSIRCFIKPTETLERSLEMNKHKGKRRVQKRPNYKNVGEEEDEEKGPTEDAQEDAEKAKGT    351 - 420
EGGSKGIKTSGESEEIEMVIMERSKLSELAASTSVQEQNTTDEEKSAAATCSESTQWSRPFLDMVYHALD    421 - 490
SPDDDYHALFVLCLLYAMSHNKGMDPEKLERIQLPVPNAAEKTTYNHPLAERLIRIMNNAAQPDGKIRLA    491 - 560
TLELSCLLLKQQVLMSAGCIMKDVHLACLEGAREESVHLVRHFYKGEDIFLDMFEDEYRSMTMKPMNVEY    561 - 630
LMMDASILLPPTGTPLTGIDFVKRLPCGDVEKTRRAIRVFFMLRSLSLQLRGEPETQLPLTREEDLIKTD    631 - 700
DVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRAL    701 - 770
NITIHKPASSPHSKPFPILQATFIFSDHIRCIIAKQRLAKGRIQARRMKMQRIAALLDLPIQPTTEVLGF    771 - 840
GLGSSTSTQHLPFRFYDQGRRGSSDPTVQRSVFASVDKVPGFAVAQCINQHSSPSLSSQSPPSASGSPSG    841 - 910
SGSTSHCDSGGTSSSSTPSTAQSPADAPMSPELPKPHLPDQLVIVNETEADSKPSKNVARSAAVETASLS    911 - 980
PSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRSLTGMPPLSTPAAACTEPVGEEAACAEPVGT    981 - 1050
AED                                                                      1051 - 1053
//

Text Mined References (76)

PMID Year Title
26203907 2015 Multiple Sclerosis Risk Allele in CLEC16A Acts as an Expression Quantitative Trait Locus for CLEC16A and SOCS1 in CD4+ T Cells.
26121298 2015 Systemic Lupus Erythematosus Patients Exhibit Reduced Expression of CLEC16A Isoforms in Peripheral Leukocytes.
25903733 2015 GWAS-identified multiple sclerosis risk loci involved in immune response: validation in Russians.
25891430 2015 Association of CLEC16A with human common variable immunodeficiency disorder and role in murine B cells.
25823473 2015 Multiple sclerosis-associated CLEC16A controls HLA class II expression via late endosome biogenesis.
25576669 2015 A variant of CLEC16A gene confers protection for Vogt-Koyanagi-Harada syndrome but not for Behcet's disease in a Chinese Han population.
25447402 2014 Association of the C-type lectin-like domain family-16A (CLEC16A) gene polymorphisms with acute coronary syndrome in Mexican patients.
25008175 2014 Fine mapping and functional studies of risk variants for type 1 diabetes at chromosome 16p13.13.
24949970 2014 The diabetes susceptibility gene Clec16a regulates mitophagy.
24646814 2014 Polymorphisms of CLEC16A region and autoimmune thyroid diseases.
More...