Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33
PubTator Score 0.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis -1.267 4.5e-02
acute myeloid leukemia 3.300 5.0e-02
acute quadriplegic myopathy 1.262 6.4e-06
adult high grade glioma 1.400 3.6e-02
astrocytic glioma 1.300 1.0e-02
Atopic dermatitis -1.200 3.3e-03
atypical teratoid / rhabdoid tumor 2.500 1.3e-04
ependymoma 1.600 6.1e-03
glioblastoma 1.500 1.3e-04
group 3 medulloblastoma 2.300 3.4e-05
juvenile dermatomyositis 1.190 2.3e-11
lung cancer 2.000 1.6e-05
medulloblastoma, large-cell 1.800 4.0e-05
nasopharyngeal carcinoma 1.100 8.8e-04
non-small cell lung cancer 1.014 2.2e-13
oligodendroglioma 1.500 1.7e-02
osteosarcoma 3.856 2.3e-12
ovarian cancer -1.800 1.2e-05
pancreatic cancer 1.100 7.7e-04
pancreatic carcinoma 1.100 7.7e-04
pancreatic ductal adenocarcinoma liver m... 1.131 3.1e-02
Pick disease 1.600 6.3e-07
primitive neuroectodermal tumor 1.200 7.1e-04
Rheumatoid arthritis 2.000 8.5e-04

AA Sequence

MNFLSTAESRTAQAAASGTTLLPQFRAPSWQTGMHSSAATELFATGPLPSTGTLPPSLSAYQHPTTFSNR      1 - 70
NFATTSPLVLQDSTFNTTSNGILSHHDPLLQIKTSQGTVPTALAFERLGSSVLSNSIPPQSSTYRSAQES     71 - 140
APHLLQPQFSLLPSALGGSQQTPQAYSSTLFTSSTASIERALLRECSVIKHHQRPSGTQSIQAQLTGSQH    141 - 210
SLHSYLSNSSVVNFQETTRQSSLSCSPIGDSTQVSNGGLQQKTSQVSVELAQSYSSAIPSSGYPPSTTKI    211 - 280
KSCSTEQPLTSTKTPKPQSIIPPVQTLSYSKPLHNQSSVISGQAQIYSTAQLPSLLSVSQSQNYGLVQPH    281 - 350
NVPSIVHSQVYRSSKVEKLPPLYKTLTFSGSSQTVTPENQTLNYSSNQQEVLSSVTNENYPAQTRDLSSV    351 - 420
SQSQSYSSGHSQGLSPVSQTQVSYSSQSQVLSVVSLSESYASGESLTLTAPSLSYSSASRAQNLPDSSPT    421 - 490
QNYISMHSSQNVQTQESSSPQSQKFLPAVQSSSFASSTHCQTLQNNITSPDPKSYAERKLDSDVYPSSKQ    491 - 560
EDGFPMQELQVLQPQASLESSTQRLSDGEINAQESTYKVSKADDRYSQSVIRSNSRLEDQVIGVALQASK    561 - 630
KEESVVGSVTQLNQQIGQVNNAATLDLKNSTNLIQTPQIRLNTKDLKQQHPLILKVHESKVQEQHDQIIN    631 - 700
ASSQIQIPNHALGHGHQASLPNTQVLLDSACDLQILQQSILQAGLGQVKASLQAQRVQSPQQIVHPFLQM    701 - 770
EGHVIQSNGDHSQQQLHPQNSEVMKMDLSESSKPLQQHLTTKGHFSETNQHDSKNQFVSLGSMCFPEAVL    771 - 840
LSDERNILSNVDDILAATAAACGVTPTDFSKSTSNETMQAVEDGDSKSHFQQSLDVRHVTSDFNSMTATV    841 - 910
GKPQNINDTSLNGNQVTVNLSPVPALQSKMTLDQQHIETPGQNIPTKVTSAVVGPSHEVQEQSSGPFKKQ    911 - 980
SATNLESEEDSEAPVDSTLNNNRNQEFVSSSRSISGENATSESEFTLGGDDSGVSMNPARSALALLAMAQ    981 - 1050
SGDAVSVKIEEENQDLMHFNLQKKRAKGKGQVKEEDNSNQKQLKRPAQGKRQNPRGTDIYLPYTPPSSES   1051 - 1120
CHDGYQHQEKMRQKIKEVEEKQPEVKTGFIASFLDFLKSGPKQQFSTLAVRMPNRTRRPGTQMVRTFCPP   1121 - 1190
PLPKPSSTTPTPLVSETGGNSPSDKVDNELKNLEHLSSFSSDEDDPGYSQDAYKSVSTPLTTLDATSDKK   1191 - 1260
KKTEALQVATTSPTANTTGTATTSSTTVGAVKQEPLHSTSYAVNILENISSSESSKPIELDGLPSDQFAK   1261 - 1330
GQDTVAIEGFTDEEDTESGGEGQYRERDEFVVKIEDIETFKEALKTGKEPPAIWKVQKALLQKFVPEIRD   1331 - 1400
GQREFAATNSYLGYFGDAKSKYKRIYVKFIENANKKEYVRVCSKKPRNKPSQTIRTVQAKPSSSSKTSDP   1401 - 1470
LASKTTTTKAPSVKPKVKQPKVKAEPPPKKRKKWKEEFSSSQSDSSPEIHTSSSDDEEFEPPAPFVTRFL   1471 - 1540
NTRAMKETFKSYMELLVSIALDPDTMQALEKSNDELLLPHMKKIDGMLNDNRKRLLLNLHLDQSFKNALE   1541 - 1610
SFPELTIITRDSKAKSGGTAISKIKMNGKAYNKKTLRTSKTTTKSAQEFAVDPEKIQLYSLYHSLHHYKY   1611 - 1680
HVYLICKDEISSVQKKNEDLGQEEIVQLCMKNVKWVEDLFEKFGELLNHVQQKCS                  1681 - 1735
//

Text Mined References (16)

PMID Year Title