Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.20
PubTator Score 0.63

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
chronic lymphocytic leukemia 244
Disease Target Count P-value
juvenile dermatomyositis 1189 2.55404888281059E-8
atypical teratoid/rhabdoid tumor 1095 1.75772659288204E-6
tuberculosis 1563 1.76953191907932E-6
primitive neuroectodermal tumor 3031 2.45920724003867E-6
sonic hedgehog group medulloblastoma 1482 3.7643536439704E-6
medulloblastoma, large-cell 6234 1.06440055012557E-5
osteosarcoma 7933 1.47354820079489E-4
ovarian cancer 8492 1.74506669932424E-4
oligodendroglioma 2849 0.0118487882997853
ependymoma 2514 0.0204183575224553
Disease Target Count Z-score Confidence
3-M syndrome 16 5.106 2.6


  Differential Expression (10)

Disease log2 FC p
ependymoma 1.300 0.020
oligodendroglioma 1.700 0.012
osteosarcoma -1.589 0.000
sonic hedgehog group medulloblastoma 2.300 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.500 0.000
juvenile dermatomyositis 1.069 0.000
tuberculosis -1.200 0.000
ovarian cancer -1.300 0.000


Accession Q2KHR2 Q6ZRR1 Q6ZTY6 Q8N3J0 Q9H7A9 Q9H956
Symbols RFXDC2


PANTHER Protein Class (2)


4QQM   4QQI  

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

18673564 RFX7 is a winged helix transcription factor expressed ubiquitously in all tissues examined, especially brain tissue.

AA Sequence

LFQQICSESMNSMTSSGFEWIESKDHPTVEMLG                                        1331 - 1363

Text Mined References (20)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20062064 2010 Common variants at 2q37.3, 8q24.21, 15q21.3 and 16q24.1 influence chronic lymphocytic leukemia risk.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.