Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.300 7.7e-04
atypical teratoid / rhabdoid tumor -1.100 2.1e-07
glioblastoma -1.200 4.3e-06
group 4 medulloblastoma -1.100 3.6e-03
medulloblastoma, large-cell -1.200 6.1e-05

AA Sequence

MGGGYDLNLFASPPDSNFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVVHMN      1 - 70
KLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQ     71 - 140
RCPLGCGATLDPAERARHNCYRELHNAWSVRQERRRPLLLSLLRRVRWLDQATSVVRRELAELSNFLEED    141 - 210
TALLEGAPQEEAEAAPEGNVGAEVVGEPRANIPCK                                       211 - 245
//

Text Mined References (2)

PMID Year Title