Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.13785851756942E-7
glioblastoma 5572 4.28223789930308E-6
medulloblastoma, large-cell 6234 6.07622927430388E-5
adult high grade glioma 2148 7.68971835369438E-4
group 4 medulloblastoma 1875 0.00357573064998235

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.300 0.001
group 4 medulloblastoma -1.100 0.004

Synonym

Accession Q2KHN1 Q8NHS5
Symbols

Gene

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

AA Sequence

MGGGYDLNLFASPPDSNFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVVHMN      1 - 70
KLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQ     71 - 140
RCPLGCGATLDPAERARHNCYRELHNAWSVRQERRRPLLLSLLRRVRWLDQATSVVRRELAELSNFLEED    141 - 210
TALLEGAPQEEAEAAPEGNVGAEVVGEPRANIPCK                                       211 - 245
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.