Property Summary

NCBI Gene PubMed Count 15
PubMed Score 28.70
PubTator Score 17.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (6)

AA Sequence

MRAPLCLLLLVAHAVDMLALNRRKKQVGTGLGGNCTGCIICSEENGCSTCQQRLFLFIRREGIRQYGKCL      1 - 70
HDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLPTCPPGTLAHQNTRECQGECE     71 - 140
LGPWGGWSPCTHNGKTCGSAWGLESRVREAGRAGHEEAATCQVLSESRKCPIQRPCPGERSPGQKKGRKD    141 - 210
RRPRKDRKLDRRLDVRPRQPGLQP                                                  211 - 234
//

Text Mined References (17)

PMID Year Title