Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.80
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -4.354 0.000
tuberculosis 2.900 0.000

Gene RIF (1)

PMID Text
17562706 CLEC12B is an inhibitory receptor on myeloid cells

AA Sequence

MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTLGMMFLQISND      1 - 70
INSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQEQMAIKLCQELIIHTSDHRC     71 - 140
NPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDS    141 - 210
SGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD        211 - 276
//

Text Mined References (7)

PMID Year Title
24091439 2013 Differential proteomic analysis of caveolin-1 KO cells reveals Sh2b3 and Clec12b as novel interaction partners of caveolin-1 and Capns1 as a potential mediator of caveolin-1-induced apoptosis.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
23834954 2013 Genome-wide association study of sensory disturbances in the inferior alveolar nerve after bilateral sagittal split ramus osteotomy.
17562706 2007 Identification of CLEC12B, an inhibitory receptor on myeloid cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.