Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.93
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 1.7e-05
osteosarcoma 7950 1.3e-04
Disease Target Count Z-score Confidence
Cholesteatoma 16 3.735 1.9
Disease Target Count
Sickle Cell Anemia 53

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.363 1.3e-04
tuberculosis 1.700 1.7e-05

Gene RIF (1)

AA Sequence

MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTLGMMFLQISND      1 - 70
INSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQEQMAIKLCQELIIHTSDHRC     71 - 140
NPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDS    141 - 210
SGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD        211 - 276
//

Text Mined References (7)

PMID Year Title