Property Summary

NCBI Gene PubMed Count 24
Grant Count 20
R01 Count 12
Funding $2,132,167.51
PubMed Score 51.09
PubTator Score 9.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.019
Waldenstrons macroglobulinemia 1.038 0.016
psoriasis 1.800 0.000
sonic hedgehog group medulloblastoma 1.500 0.000
glioblastoma 1.100 0.012
atypical teratoid/rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.100 0.000
spina bifida -1.740 0.036

Gene RIF (7)

PMID Text
26051894 By interacting with a unique domain of Esco1, Pds5 recruits Esco1 to chromatin-bound cohesin complexes to form cohesion.
21865657 The data show a downregulation of proliferation-associated host gene PDS5A and suggest a role of PDS5A in HIV-1-induced cellular pathogenesis but not viral replication.
21069257 Data show that the siRNA-mediated knockdown of Pds5A affects sister chromatid cohesion but does not influence mitotic checkpoint function or the proliferation and survival of glioblastoma multiforme cells.
20359100 Observational study of gene-disease association. (HuGE Navigator)
19454010 Interaction of HIV-1 Tat with PDS5A in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
17846787 SCC-112 improve cell proliferation and contributes to tumorigenesis by interacting with p63 and promoting cell cycling.
15019998 Findings suggest that the SCC-112 gene expression is likely to be associated with normal cell growth and proliferation.

AA Sequence

MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSEDEKQQYLPLA      1 - 70
LHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFITRQLKGLEDTKSPQFNRYFY     71 - 140
LLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHNKKVQMHMLDLMSSIIMEGDGVTQELLDSIL    141 - 210
INLIPAHKNLNKQSFDLAKVLLKRTVQTIEACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLL    211 - 280
LSVMPQLEFKLKSNDGEERLAVVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHC    281 - 350
LMNHPDLAKDLTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMM    351 - 420
GLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLETEERMKCLYYL    421 - 490
YASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLMTIAKNLPDPGKAQDFVKKFN    491 - 560
QVLGDDEKLRSQLELLISPTCSCKQADICVREIARKLANPKQPTNPFLEMVKFLLERIAPVHIDSEAISA    561 - 630
LVKLMNKSIEGTADDEEEGVSPDTAIRSGLELLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQ    631 - 700
IFRNTGHKIETDLPQIRSTLIPILHQKAKRGTPHQAKQAVHCIHAIFTNKEVQLAQIFEPLSRSLNADVP    701 - 770
EQLITPLVSLGHISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIK    771 - 840
LLVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLAQEPCYHEIIT    841 - 910
PEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDPVKERRAHARQCLLKNISIRR    911 - 980
EYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFM    981 - 1050
KKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKS   1051 - 1120
YISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAA   1121 - 1190
ETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDES   1191 - 1260
GPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAE   1261 - 1330
RQIDLQR                                                                  1331 - 1337
//

Text Mined References (39)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26051894 2015 Esco1 Acetylates Cohesin via a Mechanism Different from That of Esco2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141881 2013 Pds5B is required for cohesion establishment and Aurora B accumulation at centromeres.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21865657 2012 HIV-1 infection suppresses expression of host cell cycle-associated gene PDS5A.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21111234 2010 Sororin mediates sister chromatid cohesion by antagonizing Wapl.
More...