Property Summary

NCBI Gene PubMed Count 437
PubMed Score 0.00
PubTator Score 215.60

Knowledge Summary

Patent

No data available

Gene RIF (418)

PMID Text
26893439 IFN-gamma rs2069727 and MICA rs2596542 polymorphisms may be related to the incidence of hepatocellular carcinoma.
26708143 Our results suggest that locally sustained expression of MICA and MICB in the tumor may contribute to the malignant progression of Gastric cancer(GC) and that expression of these ligands predicts an unfavorable prognosis in GC patients presenting large tumors.
26672749 MICA polymorphisms do not appear to influence the development of ocular lesions in patients diagnosed with toxoplasmosis in this study population.
26616050 In conclusion DNT cell can significantly inhibit the growth of pancreatic carcinoma in vivo, and the mechanism may be involved in abnormal expressions of MICA and NKG2D.
26607264 gastric cancer patients who have tumors with high expression of MICA are more likely to benefit from adjuvant chemotherapy, immunotherapy and gastrectomy
26483398 The reduced cell surface expression of NKG2D in response to engagement by MICA-129Met variants appeared to reduce the severity of acute graft-versus-host disease.
26331842 The study investigates the link between Behcet's Disease and two specific HLA alleles associated with Behcet's Disease (HLA-A*26:01 and HLA-B*51:01) in terms of their binding affinity to the MICA.
26212443 Further studies of the association between HBV replication and MICA induction should be conducted.
26184953 This meta-analysis shows that the MICA-TM A6 allele and the MICA*009 allele are associated with BD susceptibility in various ethnic populations, and that MICA alleles are in strong linkage disequilibrium with HLA-B51 in BD.
26166647 Serum sMICA serum levels in non-small cell lung cancer patients is associated with metastasis.
More...

AA Sequence

MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQG      1 - 70
QWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELF     71 - 140
LSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVN    141 - 210
VTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRF    211 - 280
TCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLD    281 - 350
QHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA                                         351 - 383
//

Text Mined References (438)

PMID Year Title
27342847 2016 Alternative Splice Transcripts for MHC Class I-like MICA Encode Novel NKG2D Ligands with Agonist or Antagonist Functions.
26893439 2016 Interaction Between Polymorphisms of IFN-? and MICA Correlated with Hepatocellular Carcinoma.
26708143 2016 Clinical significance of tumor expression of major histocompatibility complex class I-related chains A and B (MICA/B) in gastric cancer patients.
26672749 2015 MHC Class I Chain-Related Gene A Polymorphisms and Linkage Disequilibrium with HLA-B and HLA-C Alleles in Ocular Toxoplasmosis.
26616050 2016 DNT cell inhibits the growth of pancreatic carcinoma via abnormal expressions of NKG2D and MICA in vivo.
26607264 2016 Tumor MICA status predicts the efficacy of immunotherapy with cytokine-induced killer cells for patients with gastric cancer.
26483398 2015 The MICA-129 dimorphism affects NKG2D signaling and outcome of hematopoietic stem cell transplantation.
26331842 2015 Molecular Dynamics Simulation Reveals the Selective Binding of Human Leukocyte Antigen Alleles Associated with Behçet's Disease.
26212443 2015 Association between hepatitis B virus and MHC class I polypeptide-related chain A in human hepatocytes derived from human-mouse chimeric mouse liver.
26184953 2015 Associations between major histocompatibility complex class I chain-related gene A polymorphisms and susceptibility to Behcet's disease. A meta-analysis.
More...