Property Summary

NCBI Gene PubMed Count 458
PubMed Score 0.00
PubTator Score 215.60

Knowledge Summary

Patent

No data available

Gene

  Ortholog (3)

Protein-protein Interaction (10)

Gene RIF (441)

AA Sequence

MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQG      1 - 70
QWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELF     71 - 140
LSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVN    141 - 210
VTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRF    211 - 280
TCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLD    281 - 350
QHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA                                         351 - 383
//

Text Mined References (459)

PMID Year Title