Property Summary

NCBI Gene PubMed Count 458
PubMed Score 0.00
PubTator Score 215.60

Knowledge Summary

Patent

No data available

Gene

PDB

1HYR   1B3J  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Protein-protein Interaction (10)

Gene RIF (441)

AA Sequence

MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQG      1 - 70
QWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELF     71 - 140
LSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVN    141 - 210
VTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRF    211 - 280
TCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLD    281 - 350
QHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA                                         351 - 383
//

Text Mined References (459)

PMID Year Title