Property Summary

NCBI Gene PubMed Count 157
PubMed Score 0.00
PubTator Score 203.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.600 3.2e-03
Breast cancer 1.600 1.9e-04
breast carcinoma 1.100 3.6e-04
chronic rhinosinusitis 1.096 2.2e-02
cutaneous lupus erythematosus 2.900 1.2e-04
cystic fibrosis 1.700 4.6e-04
esophageal adenocarcinoma 1.300 1.8e-02
gastric carcinoma 1.700 2.5e-02
glioblastoma 1.500 2.0e-03
interstitial cystitis 2.000 1.9e-03
intraductal papillary-mucinous neoplasm ... 2.500 9.2e-03
invasive ductal carcinoma 1.400 9.8e-03
lung cancer -2.000 2.2e-03
lung carcinoma -1.200 1.8e-23
Multiple myeloma 1.216 8.0e-03
osteosarcoma -1.690 6.7e-03
ovarian cancer 1.700 8.7e-04
Pilocytic astrocytoma 1.100 2.0e-03
posterior fossa group A ependymoma 1.200 2.3e-05
primary Sjogren syndrome 2.000 2.6e-04
tuberculosis 1.100 2.3e-07
ulcerative colitis 2.100 6.9e-05

Gene RIF (119)

AA Sequence

MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQG      1 - 70
QWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELF     71 - 140
LSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVN    141 - 210
VTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRF    211 - 280
TCYMEHSGNHGTHPVPSGKVLVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLD    281 - 350
QHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA                                         351 - 383
//

Text Mined References (161)

PMID Year Title