Property Summary

NCBI Gene PubMed Count 146
PubMed Score 0.00
PubTator Score 203.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 1.77338363568944E-23
tuberculosis 1563 2.30521270577231E-7
pediatric high grade glioma 2712 1.02594757442736E-5
posterior fossa group A ependymoma 1511 2.25487470171988E-5
ulcerative colitis 2087 6.87279986858832E-5
cutaneous lupus erythematosus 1056 1.19822447558161E-4
Breast cancer 3099 1.85593960599104E-4
primary Sjogren syndrome 789 2.57554327601538E-4
breast carcinoma 1614 3.60931709148706E-4
cystic fibrosis 1670 4.61511067544065E-4
glioblastoma 5572 8.26712737693446E-4
ovarian cancer 8492 8.70620671326519E-4
interstitial cystitis 2299 0.0019132327458052
pilocytic astrocytoma 3086 0.0020242902879665
lung cancer 4473 0.00216232691799797
osteosarcoma 7933 0.00674343061749556
Multiple myeloma 1328 0.00804143253155208
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00923721128295155
invasive ductal carcinoma 2950 0.00980305809872478
esophageal adenocarcinoma 737 0.0179350527878244
chronic rhinosinusitis 512 0.0221842154497752
gastric carcinoma 832 0.0246661220961697
Disease Target Count Z-score Confidence
Cancer 2346 3.58 1.8
Dengue disease 19 3.191 1.6
Disease Target Count
Rheumatoid Arthritis 1171

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.216 0.008
esophageal adenocarcinoma 1.300 0.018
cutaneous lupus erythematosus 2.900 0.000
osteosarcoma -1.690 0.007
glioblastoma 1.900 0.001
tuberculosis 1.100 0.000
intraductal papillary-mucinous neoplasm ... 2.500 0.009
lung cancer -2.000 0.002
breast carcinoma 1.100 0.000
interstitial cystitis 2.000 0.002
cystic fibrosis 1.700 0.000
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 1.100 0.002
posterior fossa group A ependymoma 1.200 0.000
primary Sjogren syndrome 2.000 0.000
lung carcinoma -1.200 0.000
gastric carcinoma 1.700 0.025
invasive ductal carcinoma 1.400 0.010
ulcerative colitis 2.100 0.000
ovarian cancer 1.700 0.001
Breast cancer 1.600 0.000
chronic rhinosinusitis 1.096 0.022

Gene RIF (108)

PMID Text
26708143 Our results suggest that locally sustained expression of MICA and MICB in the tumor may contribute to the malignant progression of Gastric cancer(GC) and that expression of these ligands predicts an unfavorable prognosis in GC patients presenting large tumors.
26071561 Genotoxic stress induces senescence-associated ADAM10-dependent release of NKG2D MIC ligands (MICA, MICB) in multiple myeloma cells.
25990310 Aligned with MICB*005:02, MICB*030 has a nonsynonymous adenine substitution at nucleotide position 50 in exon 3, leading to amino acid change from serine to arginine at codon 102 of the mature MICB molecule.
25887583 We have demonstrated a novel mechanism by which tumor-derived sMIC may temper the immune reactive tumor microenvironment.
25775242 This study suggests that NKG2D ligands shedding of MICA, MICB and ULBP-2 is a novel pathway in endometriosis complex pathogenesis that impairs Natural Killer Cells cell function.
25626490 The sMICB serum levels were significantly increased in hepatitis B patients compared to healthy controls. The sMICB serum levels were decreased in a treated hepatocellular carcinoma (HCC) patient group compared to a not-treated HCC patient group.
25363527 Estrogen upregulates MICA/B expression in human non-small cell lung cancer through the regulation of ADAM17.
25228093 MICA/B expression is inhibited by unfolded protein response and associated with poor prognosis in human hepatocellular carcinoma.
25167773 Data indicate that MHC class I chain-related protein A (MICA)( *)010, MICA( *)A5 and MHC class I chain-related protein B (MICB)( *)005:02 were the most frequent alleles.
24997223 MICb expression in macrophage foam cells infiltrating atherosclerotic plaques
More...

AA Sequence

MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQG      1 - 70
QWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELF     71 - 140
LSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVN    141 - 210
VTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRF    211 - 280
TCYMEHSGNHGTHPVPSGKVLVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLD    281 - 350
QHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA                                         351 - 383
//

Text Mined References (150)

PMID Year Title
26708143 2016 Clinical significance of tumor expression of major histocompatibility complex class I-related chains A and B (MICA/B) in gastric cancer patients.
26071561 2015 Genotoxic Stress Induces Senescence-Associated ADAM10-Dependent Release of NKG2D MIC Ligands in Multiple Myeloma Cells.
25990310 2015 Identification of a novel MICB allele, MICB*030, by cloning and sequencing.
25887583 2015 Soluble NKG2D ligand promotes MDSC expansion and skews macrophage to the alternatively activated phenotype.
25775242 2015 Soluble ligands for the NKG2D receptor are released during endometriosis and correlate with disease severity.
25626490 2015 Soluble MICB protein levels and platelet counts during hepatitis B virus infection and response to hepatocellular carcinoma treatment.
25363527 2015 Estrogen upregulates MICA/B expression in human non-small cell lung cancer through the regulation of ADAM17.
25228093 2014 MICA/B expression is inhibited by unfolded protein response and associated with poor prognosis in human hepatocellular carcinoma.
25167773 2014 MIC gene polymorphism and haplotype diversity in Zhuang nationality of Southern China.
24997223 2014 MICA/B expression in macrophage foam cells infiltrating atherosclerotic plaques.
More...