Property Summary

NCBI Gene PubMed Count 1,697
PubMed Score 1568.81
PubTator Score 6027.77

Knowledge Summary

Patent

No data available

 GO Function (1)

Protein-protein Interaction (10)

Gene RIF (1648)

PMID Text
26967484 HLA-B alleles are associated with dermatitis herpetiformis in Chinese population.
26841353 KIR-3DL2 binding to HLA-B27 licenses Th17 cell differentiation in spondyloarthritis.
26819491 HLA-B13:02, HLA-B38:02, HLA-B44:03, and HLA-B56:01 alleles were significantly increased in autistic subjects. HLA-B18:02 and HLA-B46:12 alleles were negatively associated with autism when compared to normal controls.
26787826 The results show that natural polymorphisms within HIV-1 Nef modulate its interaction with natural polymorphisms in the HLA cytoplasmic tails, thereby affecting the efficiency of HLA downregulation and consequent recognition by HIV-specific T cells.
26758079 All three B*35 subtypes showed a tapasin-independent mode of peptide acquisition. HLA-B*35-restricted peptides of low- and high-binding affinities were recovered in the presence and absence of tapasin
26669670 The HLA-B*35 antigen contributes to endoplasmic reticulum stress and inflammation in limited cutaneous systemic sclerosis patients.
26640809 The functional IL-6 polymorphism rs1800795 is associated with intermediate uveitis but not with HLAB27 acute anterior uveitis.
26613595 four amino-acid positions of HLA-B and -C account for most of the associations between ankylosing spondylitis and MHC in the Korean population
26610302 Study replicated the HLA-B*27 association with acute anterior uveitis , and confirmed that HLA-B*27 homozygosity further increases the risk of AAU almost twofold.
26599303 we found a significant association between carbimazole/methimazole-induced agranulocytosis and HLA-B*38:02:01
26560062 Our data suggest that the presence of HLA-B15 favours the development of isolated/combined peripheral rather than isolated axSpA, while HLA-B27 promotes an isolated/combined axial disease and excludes a peripheral pattern
26555631 The findings of this study do not confirm previous studies showing an evident association between mild cADR from carbamazepine and HLA-A*31:01.
26494593 Changes in key regulators of the Wnt pathway as well as Indian hedgehog, a molecule regulating endochondral ossification, are found in HLA-B27 carriers, independent if they were healthy or affected by uveitis or spondyloarthritis.
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26469786 interaction between HLA-B60 and HLA-B27 is a better marker for the risk of AS susceptibility in a Taiwanese population
26416272 Data suggest that tapasin (Tsn) binds to MHC I with suboptimal cargo and thereby adjusts the energy landscape in favor of MHC I complexes with immunodominant epitopes.
26395086 Data indicate that inflammatory back pain (IBP) characteristics forecasting the presence of sacroiliitis on magnetic-resonance-imaging (MRI) or HLA-B27 antigen.
26375851 antigen presentation for a broad panel of HLA molecules
26355081 these results suggest that B*13-associated escape mutations impair HIV-1 replication by two distinct mechanisms, that is, by reducing Gag fitness and dampening Nef immune evasion function.
26331842 The study investigates the link between Behcet's Disease and two specific HLA alleles associated with Behcet's Disease (HLA-A*26:01 and HLA-B*51:01) in terms of their binding affinity to the MICA.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking
26314893 HLA-B*27:05 and HLA-B*27:04 were the most common HLA-27 subtypes in both Juvenile idiopathic arthritis and Ankylosing spondylitis in northern India.
26282450 The findings of this study suggested the presence of HLA-related genetic risk factors for LTG-induced MPE in the Korean population.
26273634 JAS with different B27 subtypes had similar features in most of manifestations; JAS and AAS patients with the same subtype could have distinctive courses.
26258424 Cell surface expression level variation between two common human leukocyte antigen alleles, HLA-A2 and HLA-B8, is dependent on the structure of the C terminal part of the alpha 2 and the alpha 3 domains.
26248534 Results show a significant relation between the presence of HLA-B27 and ankylosing spondylitis in Moroccan population.
26199258 The HLA-DRB1*15 allele, the A*01/B*08/DRB1*03 haplotypes, and the homozygosity of HLA-A*01 and HLA-A*02 may play a presumptive predisposing factor in Acute Myeloblastic Leukemia.
26169100 These results demonstrate diverse spatiotemporal expression patterns for MHC class I molecules in the prenatal human CNS.
26133380 The IL2RA rs11594656 and rs12722495 polymorphisms are associated with intermediate uveitis but not with HLA-B27 acute anterior uveitis.
26125763 patients. Understanding the distribution of HLAB27 subtypes in ethnic minority populations of Xinjiang is important for anthropological genetic studies and for analyzing the impact of genetic background on ankylosing spondylitis susceptibility.
26083016 Sensitivity and specificity were considered the primary end points and were 100% across the four populations for rs2395029-HLA-B*57:01. SNP prediction of HLA-A*31:01 had 100% sensitivity and 84% specificity
26070312 HLA-B27 single nucleotide polymorphisms are the genetic determinants of cocaine-associated agranulocytosis.
26068923 HLA-B*5701 allele exerts a favorable effect on the immunological (higher baseline and nadir CD4+ T cell count) and virologic (lower pretreatment HIV viral load) variables.
26057149 HLA Class I (HLA- A, -B, -C) antigens are downregulated by LMP2A protein in Epstein-Barr virus-infected gastric cancer cells.
26036218 Genotypes at rs2844682 and rs3909184 have no clinical value in identifying HLA-B*15:02 carriers of Han Chinese or other Asian ancestry
25994336 epistatic interaction between ERAP1 and the HLA class I alleles HLA-B*27 and HLA-B*40:01 affects susceptibility to ankylosing spondylitits
25976429 This alteration of the secondary structure probably affects the maturation of the heavy chain and the level of surface expression, making the HLA-B*38:55Q undetectable by standard serological typing
25972545 RSV infection of lung epithelial cells induces expression of RIG-I, NLRC5, and subsequent upregulation of HLA-A, HLA-B and HLA-C.
25962691 In mothers and daughters concordant for HLA-B27-positive ankylosing spondylitis daughters had a more prominent effect achieving faster complete disease remission using TNF-alpha inhibitors.
25956157 Results suggest that it is the presence of rare syntenic SEC16A and MAMDC4 deletions that increases susceptibility to axial spondyloarthritis in family members who carry the HLA-B*27 allele.
25953150 The data in the present research demonstrated a strong positive association between HLA-B*4601,HLA-DRB1*0901, HLA-B*4601-DRB1*0901, and juvenile ocular MG in southern China.
25948071 Phenotypic heterogeneity of HLA-B found in the pathogenesis of psoriatic arthritis.
25940109 Although we were not able to formally replicate the association with IL10 and IL23R-IL12RB2, we do report that BD in Iran is strongly associated with HLA-B*51, MICA-A6, and the three HLA-linked SNPs
25934581 Pharmacogenetics of abacavir hypersensitivity: A systematic review and meta-analysis of the association with HLA-B*57:01.
25931203 Patients with Takayasu arteritis (TAK) complicated with ulcerative colitis (UC) showed significant enrichment of HLA-B*52:01 compared to TAK patients without UC.
25922880 The prevalence of HLA-B*57:01 allele causing abacavir hypersensitivity in HIV-infected patients is 4.9%.
25918017 a strong association between HLA-B*59:01 and methazolamide-induced Stevens-Johnson syndrome and toxic epidermal necrolysis in the Han Chinese population
25894610 These results suggest an inverse association between H. pylori seropositivity and HLA-B27-positive acute anterior uveitis.
25889603 study indicates that HLA-B*41:02 is associated with the susceptibility to Henoch-Schonlein purpura in Spanish patients irrespective of HLA-DRB1 status
25889189 The HLA-B*51 allele and the major histocompatibility complex are independent risk factors for Behcet's disease in Iran.
25877443 the association between HLA-B*5701 and abacavir-induced hypersensitivity reaction (ABC-HSR) is strong in studies using immunologic confirmation to identify ABC-HSR
25872744 Control of HIV replication can be maintained in HLA-B27-positive patients despite of viral mutations in HLA-B27-restricted epitopes.
25827531 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25809376 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25781986 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25754738 relative expression levels of HLA-A, HLA-B, HLA-C, and HLA-E proteins for the specific haplotype A*02:01, B*44:02, C*05:01, which were characterized using two independent methods based on flow cytometry and mass spectrometry.
25752521 If confirmed in independent studies, these tag SNPs could be used as a reliable, simple and cost-effective alternative for genotyping a subset of HLA-B alleles.
25746818 Results show that HLA-B homozygocity, HLA-B51 alleles and higher viral loads are associated with the most rapid disease progression.
25701112 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25700963 HLA sharing of couples is associated with the occurrence of recurrent miscarriage; meta-analysis
25684766 HLA-B27 positivity was associated with an increased mortality rate in a cohort of veterans clinically selected for B27 testing, after adjustment for spondylarthritis.
25677350 The finding suggests that the ethnic genetic variations of HLA-B may greatly affect the host immune responses against hepatitis C virus.
25666956 Our results demonstrated the association of HLA-C*03 and HLA-DRB1*01 alleles with Macedonian autistic patients
25647819 HLA-B*15:02 was strongly associated with carbamazepine-induced Stevens-Johnson syndrome/ toxic epidermal necrolysis
25636577 genetic polymorphism (HLA-Bw4 allele) is not related to acute myeloid leukemia in Chinese population
25634791 family study of recurrent HLA-B56 mediated neonatal alloimmune thrombocytopenia with fatal outcomes
25626601 The study aims to assess the distribution of HLA-A, -B, -Cw and DRB1 alleles in Moroccan patients with ankylosing spondylitis (AS) and to compare the clinical features of AS and the frequencies of HLA-B27 in patients from Morocco.
25620704 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25606786 Describe a novel approach for quantitating differences in HLA B-cell epitope electrostatic potential which may allow prediction of HLA immunogenicity.
25589651 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25582852 These findings provide novel insights about the molecular basis of KIR3DL2 binding to B27
25566896 In this article we report two cases of allopurinolinduced drug eruptions in patients carrying the HLAB*5801 allele.
25549594 may present as a genetic susceptibility factors in Iranian patients with Non-Hodgkin's lymphoma
25545232 donors carrying the B*58:01-TNF2 haplotype may cause more serious complications and poorer outcomes to ALL recipients
25521205 HLA-B is the main risk factor for primary sclerosing cholangitis in the MHC.
25495410 Our data suggest the HLA-A*02:01:01/-B*35:01:01/-C*04:01:01 haplotype may be a biomarker for LTG-induced maculopapular exanthema and the HLA-C*08:01 allele for PHT-induced MPE.
25480565 the strict conformation of HLA-Bw4 allotypes, held in place by the Glu(76)-Arg(83) interaction, facilitates KIR3DL1 binding, whereas Bw6 allotypes present a platform on the alpha1 helix that is less permissive for KIR3DL1 binding.
25428396 We found a statistical association between HLA-B*1502 and lamotrigine-induced SJS/TEN in Han Chinese subjects
25413106 Among 17 alleles so far observed only once in our population, 6 (A*24:41, B*07:02:28, B*35:03:03, B*39:40N, DRB1*13:23 and DRB1*14:111) belong to very rare alleles, 2 (B*44:16 and DRB1*01:31) belong to rare alleles
25355886 This work shows that the alleles HLA-A*33 and HLA-B*44 are significantly enriched in postherpetic neuralgia patients, while HLA-A*02 and HLA-B*40 are significantly depleted.
25330014 Individuals who carried both KIR3DS1 and Bw4*80I did not remain HIV seronegative longer than those from a control group who were homozygous for HLA-Bw6 and carried no HLA-A locus Bw4 alleles
25327504 Clinical features of and genetic predisposition to drug-induced Stevens-Johnson syndrome and toxic epidermal necrolysis in a single Korean tertiary institution patients-investigating the relation between the HLA -B*4403 allele and lamotrigine
25305458 HLA-B*1502 is a risk factor for carbamazepine induced Stevens-Johnson syndrome in North Indian population.
25295286 Data indicate that positivity for class I histocompatibility antigens HLA-A and HLA-B types did not differ significantly in Common variable immunodeficiency (CVID) and immunoglobulin (Ig) G subclass deficiency (IgGSD) patients.
25286002 Because of the high frequency of HLA-B( *)57:01 allele in the majority population of Costa Rica, the risk of developing abacavir hypersensitivity in the HIV patients must be closely monitored.
25275127 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25266342 the importance of testing for HLA-B*15:02, irrespective of the ancestral background, including populations with low allele frequency
25261574 Different HLA susceptibility genes were associated with particular features that defined the psoriatic arthritis phenotype of a given patient.
25243920 Human herpesvirus 6B immediate-early I protein contains functional HLA-A*02, HLA-A*03, and HLA-B*07 class I restricted CD8(+) T-cell epitopes.
25234663 84% of this cohort of ankylosing spondylitis patients were HLA-b27 positive. HLA-b27 negative status was associated with comorbid psoriasis.
25226169 HLA-B alleles associated with better HIV control do not confer disease tolerance.
25209151 Resolution of HLA-B*44:02:01G, -DRB1*14:01:01G and -DQB1*03:01:01G reveals a high allelic variability among 12 European populations.
25193656 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
25187890 Antiepileptic drugs-induced skin rash can occur independently HLA-B*1502 genotypes in the Korean patients.
25187574 Peptide handling by HLA-B27 subtypes influences their biological behavior, association with ankylosing spondylitis and susceptibility to ERAP1.
25187353 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25154780 Identification and characterisation of peptide binding motifs of six autoimmune disease-associated human leukocyte antigen-class I molecules including HLA-B*39:06.
25146482 Molecular dynamics simulations indicate a significantly higher conformational flexibility of the F pocket in the absence of a peptide for B*44:02 compared to B*44:05.
25139336 Characterizing Maori and Polynesians is a paucity of HLA-B allotypes recognized by KIR.
25128507 HLA-B27 is more common in patients with undifferentiated arthritis than controls. However, the yield of HLA-B27 testing in arthritis is low. results suggest that HLA-B27 testing should be reserved for patients with additional spondyloarthritic features.
25102180 We identified three known loci (TCF7L2, HMGA2 and KCNQ1) and two novel loci (HLA-B and INS-IGF2) at genome-wide significance (4.15 x 10(-94)
25099678 Trans-ethnic study confirmed independent associations of HLA-A*02:06 and HLA-B*44:03 with cold medicine-related Stevens-Johnson syndrome with severe ocular surface complications.
25099164 summarize evidence from the published literature supporting these associations and provide recommendations for the use of phenytoin based on CYP2C9 and/or HLA-B genotype
25062414 The HLA-B5109 allele may be protective against papulopustular skin lesions, whereas HLA-B5103 may be a risk factor for neuro-Behcet in Turkish patients with Behcet disease.
25008926 HLA-B*27 and HLA-B*57 are associated with the selection of escape HIV mutants.
24979673 HLA-DRB1*15:01, HLA-DQB1*06:02, HLA-B*46:01 and HLA-DRB1*09:01 may be associated with severity of aplastic anemia.
24965469 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24963477 results demonstrated that the HLA-A*68, HLA-B*51, and HLA-DRB1*15 alleles were significantly more frequent in HD patients in comparison to controls
24956250 This meta-analysis demonstrates an excellent diagnostic accuracy of HLA-B*57:01 testing to detect immunologically confirmed abacavir hypersensitivity and corroborates existing recommendations.
24929144 KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C patients.
24917365 Data show that the frequency of HLA-B* 3501 allele was significantly higher in postmenopausal osteoporosis patients than in the control group.
24904546 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24887019 Data indicate a significant association of HLA-Bw4 with isoleucine at amino-acid position 80 (HLA-Bw4-80I) was found in the HLA-B*51(-) German and Turkish Behcet's disease (BD) patients.
24871931 There is a significant association between HLA-B*1502 and Phenytoin or Lamotrigine-induced SJS
24853499 Authors observed differences in HIV disease outcome associated with specific HLA-B35 alleles.
24835397 HLA-B27, but not HLA-B7, immunodominance to influenza is ERAP dependent.
24829406 the Nt-acetylation not only alters the conformation of the peptide but also switches the residues in the alpha1-helix of HLA-B*3901, which may impact the T cell engagement.
24790147 Distinct assembly profiles of HLA-B molecules.
24782188 Neuro-Behcet's disease is a severe condition in which patients with the HLA-B51 allele appear to experience a worse prognosis.
24781922 We propose that HLA-A*02:06 and HLA-B*44:03 be considered as strong risk factors for CM-SJS/TEN with SOC.
24771481 Altered bone material properties in HLA-B27 rats include reduced mineral to matrix ratio and altered collagen cross-links.
24762294 Data indicat taht of the 880 reports on B*57:01 samples, 93.4% were correctly assigned as B*57:01.
24755352 The frequency of KIR3DL1 with HLA-Bw4 was significantly lower in diffuse large B-cell lymphoma patients than in controls.
24748005 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24740510 Functional avidity and IL-2/perforin production is linked to the emergence of mutations within HLA-B*5701-restricted epitopes and HIV-1 disease progression.
24740510 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24737799 Immunocompetent subjects carrying the homozygous A haplotype or the HLABw4(T) allele are at higher risk of developing symptomatic disease after primary cytomegalovirus infection.
24731753 HLA-B( *)57:01-associated floxacillin-induced liver injury.
24718028 38-0.99) P<0.05), as previously described. These data corroborate the existence of significant differences in HLA-B allele frequencies among the distinct AIDS progression profiles
24717292 Donor mismatches at HLA-B loci contributed to the development of HLA-specific antibodies in patients listed for repeat renal transplantation.
24716975 we identified and validated one fusion gene, HLA-E and HLA-B, located 1 MB apart.
24691290 HLA-A, -B and -DRB1 allele frequencies and their haplotype frequencies in 21,918 Chinese residents living in Liaoning Provinc, were investigated.
24666027 Both HLA-B27 and ERAP1 are ankylosing spondylitis genetic susceptibility genes in the Beijing Han population.
24661088 abnormal immunophenotypic profile of peripheral lymphocytes was found in patients with BD, HLA-B51 expression was not found to be related to the expression of other cell markers.
24600035 Data indicate TCR complexed with 8-mer peptide epitope presented by the protective allele HLA-B*51:01.
24597466 This review discusses informed decision- making regarding the use of HLA-B*15:02 and HLA-A*31:01 genetic testing because of the risk of carbamazepine-induced hypersensitivity reactions reported among various ethnic groups.
24591375 Data suggest that oxypurinol (OXP) binds to the peptide-binding groove of HLA-B*58:01 with higher affinity.
24566094 These data indicate the existence of a protective effect of HLA-B*57 across ethnic groups and highlight HLA-B*35:05 as an allele uniquely protective in subtype CRF01_AE-infected Thais.
24563253 Data indicate the impact of KIR3DL1 polymorphism on peptide-laden HLA recognition.
24554773 Results indicate the role of HLA class I molecules HLA-A, HLA-B and HLA-C in NK cell maturation and KIR repertoire acquisition.
24534717 Ankylosing spondylitis can occur in the absence of HLA-B27; only about 10% of HLA-B27-positive subjects develop the disease, and even HLA-B27-positive identical twins can be discordant for disease incidence as well as severity.
24533711 The pharmacogenetic test developed in our laboratory for the fast screening of HLA-B*57:01 can be successfully implemented into routine clinical practice.
24517468 HLA-B8 is the strongest risk factor in large duct primary sclerosing cholangitis.
24501417 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24498994 HLA-B27 subtypes are associated with uveitis and dactylitis among ankylosing spondylitis patients in China
24498993 no associations between non-HLA-B27 loci and ankylosing spondylitis in a Portuguese population
24496695 Data suggest taht HLA-B*1511 may be a risk factor for some patients with carbamazepine (CBZ)-induced Stevens-Johnson syndrome (SJS) negative for HLA-B*1502.
24495362 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24453969 HIV protective KIR3DL1/S1-HLA-B genotypes influence NK cell-mediated inhibition of HIV replication in autologous CD4 targets.
24428874 Report no relationship between plasma homocysteine levels and HLA-B51 in Behcet's disease.
24415937 In vivo functions of CPSF6 for HIV-1 as revealed by HIV-1 capsid evolution in HLA-B27-positive subjects.
24400003 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24399721 HLA-B*15:02 may be necessary,but not sufficient to cause CBZ-SJS/TEN among Han Chinese living in northeastern China.
24390323 HLA-B*57 elite suppressor and chronic progressor HIV-1 isolates replicate vigorously and cause CD4+ T cell depletion.
24390108 Seronegative spondyloarthritis is strongly correlated to HLA-B27.
24389314 genetic polymorphism is associated with nasopharyngeal carcinoma among a Han population in Northwestern China
24380790 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24364037 These results might suggest opposing effects of the HLA-B*40 in the genetic susceptibility to develop ALL or AML and offer the possibility to study further the molecular mechanisms of cell differentiation within the bone marrow lineage.
24362932 We suggest that the identical short amino acid sequences shared between human viruses and HLA-B27 peptides may play a role in the pathogenesis of AS.
24352655 The significant and complex effects of co-occurring ERAP1 polymorphisms on multiple HLA-B27 ligands, and their potential to alter the immunological and pathogenetic features of HLA-B27 as a function of the ERAP1 context.
24351517 With an estimated prevalence of 75.0% in spondyloarthritis and 6.9% in healthy controls, HLA-B27 increased the disease risk 39-fold, as compared with HLA-B27 negative subjects in this French cohort.
24349500 combinations of KIR3DL1/HLA-Bw4, KIR2DL2/HLA-C1, and a genetic variant of the IL28B gene are predictive of the response to PEG-IFN and ribavirin therapy in Japanese patients infected with genotype 1b HCV.
24339913 a positive correlation between the number of escape and compensatory mutations in Gag and the replication fitness of biological HIV-1 variants isolated from HLA-B*57/58:01 patients
24339913 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24336023 Results show the presence of HLA alleles contributing toward risk of as well as protection against various carbamazepine-induced cutaneous adverse drug reactions.
24326010 rs9266406, rs9266490, and rs6910516 SNPs werwe associated with Behcet's disease.
24324956 allicin significantly inhibited HLA-B27 protein translation but failed to suppress HLA-B27 gene transcription in AS mice, indicating a posttranscriptional mechanism of this modulation.
24324503 The frequency of HLA-A *33:03:01G was increased in persistent HBV infection group, while frequency of HLA-B *13:01:01G was increased in HBsAg clearance group.
24308748 genetic association studies in Chinese Han population of Shandong coastal areas of China: Data suggest that HLA-B*51:01 is a genetic susceptibility allele for papillary thyroid carcinoma (in addition to age and sex) in the population studied.
24286455 Data indicate that in Maori with ankylosing spondylitis (AS) who were HLA-B27 positive, 76.9% were positive for HLA-B*2705.
24286189 Data indicate that in addition to HLA-B*57 as a risk factor in Behcet's disease (BD), three single nucleotide polymorphisms (SNPs)located in IL23R and one of the SNPs in IL10 were found to be significantly associated with susceptibility to BD.
24261772 B2704 might be a potential risk factor, however, B2703, B2706, and B2707 might be potential protective factors of ankylosing spondylitis, especially in Asia (Meta-Analysis)
24257027 not risk factors for acute anterior uveitis
24245727 The effect of HLA-B*57 on viral control is more pronounced during the later stages of primary HIV-1 infection, which suggests the underlying mechanism of control occurs at a critical period in the first several months after HIV-1 acquisition.
24223975 concerted aminoproteolytic activity of ERAP 1 and ERAP2
24158818 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24157097 Our data add further support to the strong association of the HLA-DQB1( *)06:02 allele with narcolepsy, especially in narcolepsy+cataplexy patients.
24152261 HLA-B*13:01 was associated with the development of the dapsone hypersensitivity syndrome among patients with leprosy.
24151602 As anti-TLR4 monoclonal antibodies, rheum Polysaccharide can also inhibit the secretion of cytokines produced by monocytes from HLA-B27 positive AAU patients of convalescence stage.
24131020 The aim of the study was to investigate and compare the clinical manifestations between HLA-B27(+) and HLA-B27(-) ankylosing spondylitis (AS) patients.
24113999 Co-expression of HLA-B7 and HLA-B27 alleles is associated with B7-restricted immunodominant responses following influenza infection.
24084328 High HLA-B44 expression is associated with lower risk of BK viremia.
24059286 Different KIR3DS1, KIR3DL1 and HLA-Bw4 genotypes and levels of transcripts associate with HIV disease progression.
24055898 The HLA-B*39 allele increases type 1 diabetes risk conferred by HLA-DRB1*04:04-DQB1*03:02 and HLA-DRB1*08-DQB1*04 class II haplotypes.
24046013 Data indicate the association of HLA-A, -B, -C, and -DRB1 incompatibilities with adverse outcome in hematopoietic stem cell transplantation (HSCT).
24041011 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
24033735 HLA-B*38 allele associated with retinopathy of prematurity
24029662 Data indicate an association of HLA-B*35 with HIV infection susceptibility, and the frequency of HLA-B*35 allele was found significantly higher in HIV seropositivity.
24028501 Endoplasmic reticulum aminopeptidase-1 alleles associated with increased risk of ankylosing spondylitis reduce HLA-B27 mediated presentation of multiple antigens.
24023945 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23994122 3 locus haplotype analysis of HLA-A, B and DR revealed significantly increased frequency of A( *)24-B( *)40-DRB1( *)15 haplotype among patients with pulmonary tuberculosis than controls, while A( *)02-B( *)40-DRB1( *)16 and A( *)02-B40-DRB1( *)03 were significantly reduced in the patients
23993278 review of current understanding of the causes and consequences of HLA-B27 misfolding and ankylosing spondylitis[review]
23992015 HLA-B*51:01:02 polymorphisms are associated with risk of cervical squamous epithelial cell carcinoma
23986795 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23984333 HLA-B alleles carrying Bw4 epitope present the highest capability of interaction with KIR3DL1 *001 compared to the HLA-B alleles presenting Bw6.[HLA-Bw4]
23956249 Radiographic progression of ankylosing spondylitis was faster in male patients who were HLA-B27 positive.
23953521 Report HLA-B allele and haplotype frequency in Turkish chronic kidney disease patients undergoing renal dialysis.
23937715 B27 subtype not associated with cardiac conduction abnormalities in ankylosing spondylitis
23916069 biology of HLA-B27 from the genetics to the biochemistry and to structural/dynamical properties of B27:peptide complexes as obtained from atomistic molecular dynamics simulation; overall,results point at antigen presentation as key event in ankylosing spondylitis pathogenesis [review]
23910730 review of the literature on non-canonical forms of HLA-B27 and the immune receptors they bind to and discussion of the possible relevance of these interactions to the pathogenesis of spondyloarthropathy [review]
23899968 Anterior uveitis is a frequent extra-articular manifestation in spondyloarthritis patients, positively associated with axial involvement and HLA-B27 and negatively associated with peripheral involvement and psoriatic arthritis.
23894643 regulation of ELAVL1/HuR in HLA-B27-expressing U937 monocytic cells
23884208 We found a strong relationship between the HLA-B*1502 allele and carbamazepine-induced SJS and TEN in Han-Chinese, Thai, and Malaysian populations.
23873822 Two amino acids in HLA-B protein are strongly associated with Takayasu arteritis susceptibility.
23853598 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23847689 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23835632 This study deministrated that HTLV-1-associated myelopathy/tropical spastic paraparesis was significantly associated with HLA-B 07 and HLA-DRB1 01:01.
23830516 IL12B and HLA-B*52:01 regions are two synergistic susceptibility loci of Takayasu arteritis in a Japanese population.
23829937 There was no significant association between oxcarbazepine-induced maculopapular eruption and HLA-B*1502 in the northern Han Chinese population in this study.
23804219 Differences in the formation of free heavy chain ligands for KIR3DL2 by HLA-B*27:05 and HLA-B*27:09 could contribute to the differential association of these alleles with Arthritis
23800305 The ERAP1 SNP rs30187 was associated with the risk for HLA-B27-positive ankylosing spondyloarthritis.
23740229 Our data suggest that HLA-B27 misfolding occurs in the gut of ankylosing spondylitis patients and is accompanied by activation of autophagy rather than a unfolded protein response.
23729098 Iraqi subjects positive for HLA-B51 are 7.4 times more likely to have Behcet's disease than normal healthy controls.
23724919 Data indicate that 44 HLA-A, 67 HLA-B and 48 HLA-DRB1 most probable alleles were identified.
23692434 The results of this study confirmed that the strong association between HLA-B*15:02 and CBZ-SJS/TEN in Hong Kong Han Chinese
23678182 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23677320 These findings imply that weak HIV-1 p24-specific CD8(+) T cell responses might play an important role in the control of HIV viremia in B*44 allele-positive individuals.
23669020 there is an association between HLA-B*58:01 and allopurinol-induced adverse drug reactions in a Japanese sample population
23638805 The most frequent haplotypes that may be associated with susceptibility to American cutaneous leishmaniasis were A*02 B*44 DRB1*07 (P = 0.0236) and A*24 B*35 DRB1*01 (P = 0.0236).
23636221 Studies indicate that HLA antigens DR8, B*57:03 and DRB1*07:01 were associated with hepatitis C virus (HCV) clearance.
23614044 The rs703842 A>G polymorphism of CYP27B1 may play a role in HLA-B27-associated uveitis.
23604100 There is a strong association between HLA-B*1301 and dapsone induced hypersensitivity reactions in leprosy patients.
23600531 Results show that Portuguese patients carrying HLA-B58 antigen and Steven-Johnson Syndrome are at increased risk of severe cutaneous drug reactions
23600465 A meta-analysis found a significant association between psoriasis and 50 HLA-B alleles.
23590408 Data show that the sequence of HLA-B*27:79 has one nucleotide mutation at position 437(A-->T) compared with the allele B*27:04:01.
23588310 HLA-B 15:02 as genetic markers for carbamazepine hypersensitivity in children
23569211 SB47 TCR engaged HLA-B*35:08(LPEP) using a completely distinct binding mechanism, namely "bypassing" the bulged peptide and making extensive contacts with the extreme N-terminal end of HLA-B*35:08.
23536655 Epstein-Barr virus negativity is associated with HLA-C and HLA-Bw4 variants among individuals older than 60 years.
23527218 Novel interaction between proliferating cell nuclear antigen and HLA I on the surface of tumor cells inhibits NK cell function through NKp44.
23521884 Data indicate that cross-reactive CD8+ T cell clonotypes were mobilized to counter the rapid emergence of HIV-1 variants immunodominant p24 Gag-derived epitope KK10 presented by T cell receptor (TCR) HLA)-B*2705 recognition.
23505543 HLA-B27 positive patients with RA do not have more enthesitis as assessed with US than the patients lacking this HLA allele. However, HLA-B27 could be shaping the RA phenotype towards RF seronegativity and axial involvement.
23490051 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23462218 This study highlighted independent effects of HLA-B and HLA-C alleles on HIV-disease progression.
23430249 Natural HLA-B*2705 protein ligands with glutamine as anchor motif: implications for HLA-B27 association with spondyloarthropathy.
23376458 Data indicate that the class II DQA1*03:01-DQB1*03:02 haplotype was not associated with complications, but the class I allele B*39:06 suggested a strong positive association with complications.
23376085 there is no significant tendency of the mutant gene contribution to the resistance after the elimination of the HLA-B*14:02-DRB1*01:02 linked mutants.
23356447 Our study suggests that factors other than HLA-B27 play a role in the association of Familial Mediterranean fever and spondyloarthritis/ankylosing spondylitis
23349864 different HLA loci(HLA-A and HLA-B) are differentially regulated during differentiation of stem cells.
23349666 phosphorylation of STAT-1 serine 727 residue is prolonged in HLA-B27-expressing monocyte-macrophage U937 cells after bacterial infection
23330836 Association of human leukocyte antigen class I antigens in Iranian patients with pemphigus vulgaris.
23329888 the HLA-B*46 allele is a risk factor for Graves' disease in Asian populations.
23328091 HLA-B*5801 and HLA-DRB1*0102 were independently associated with increased likelihood of hepatotoxicity
23289738 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23278608 the distribution of human leukocyte antigen (HLA) class I and II alleles in Turkish patients with pemphigus.
23272049 stromal interaction molecule 1 has a role in erythrocyte sedimentation and C-reactive protein activity in HLA-B27 positive ankylosing spondylitis patients
23266622 Our data suggest a possible association of KIR/HLA variants and the severity of Gaucher disease.
23252655 HLA-B27 allele distribution in controls is lower than other reports in Caucasian populations.
23246585 Data indicate that full length genomic sequence from a single long-range PCR amplicon for 15 common and well-documented HLA-A, HLA-B and HLA-C alleles were obtained.
23245688 Down-regulation of human leukocyte antigen class I (HLA-I) is associated with poor prognosis in patients with clear cell renal cell carcinoma.
23232549 A variant allele of the human leukocyte antigen (HLA)-B, HLA-B*58:01, associates strongly with allopurinolinduced SCAR.
23229474 Using human beta(2)m and the HLA-B*27:09 complex as a model system, a comparison of free and HC-bound beta(2)m by nuclear magnetic resonance spectroscopy was initially carried out. Most parts of beta(2)m gain rigidity upon binding to the heavy chain.
23220495 Data indicate that HLA-B+07/TPR specific CD8+ T cells express higher levels of PD-1 than HLA-A+02/NLV specific cells.
23215727 Four different B*35 alleles (*35:01, *35:02, *35:03, *35:08) were found among Croatian donors.
23202450 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23200758 Data indicate estimated HLA-A, -B, -C, -DRB1 haplotype and allele frequencies of donors within DKMS German Bone Marrow Donor Center with parentage from 17 different countries.
23190492 The discovery of B*58:01:12 adds further polymorphism of B*58:01 in Taiwanese population.
23177929 This study demonistrated that HLA-B may increase risk for schizophrenia.
23176610 TNF-alpha-308 G/A polymorphism was strongly associated with HLA-A*2, -A*33, -B*58, and -DRB1*03 alleles in Han-nationality lung transplant recipients.
23170180 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23121897 Two novel human leucocyte antigen (HLA) class I alleles have been identified in two Italian individuals.
23103378 Polymorphisms outside the peptide binding region of the HLA-B can play a key role in HIV progression through interaction with other immune-relevant receptors.
23089920 presence of HLA-B35 may simultaneously predispose to progression to AIDS and toxoplasmic retinochoroiditis.
23087682 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23079801 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23071161 High frequency of HLA B62 in fulminant type 1 diabetes with the drug-induced hypersensitivity syndrome.
23068784 Immunodominance of HLA-B27-restricted HIV KK10-specific CD8(+) T-cells is not related to naive precursor frequency.
23061377 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
23055271 The resukts of this study observed the strongest association in the HLA class I region at rs7750641 in patient with myasthenia gravis.
23025739 study describes first reported cases of phenytoin-related drug-induced hypersensitivity syndrome in unrelated Indigenous Australians with the same HLA-B*56:02 allele which might represent a novel genetic susceptibility factor for this syndrome
23021043 In Sardinia, the Behcet's disease-associated HLA-B*5101 allele is inherited as part of two distinctive haplotypes differently distributed in patients and controls.
23020308 HLA-B*46:01 confers susceptibility to Hashimoto disease in Han Chinese children.
23015131 Study show optimal linear SVM (support vector machine) models with high predictive capabilities for both HLA-B*5701 and B*5801.
23004006 HLA-B*50 antigen is associated with chronic spontaneous urticaria in Brazil
22997432 We conclude that HLA-B7-restricted islet epitopes display weak HLA-binding profiles, are different in children and adults with type 1 diabetes mellitus.
22981956 The frequency of HLA-B49 antigen is significantly lower in Type I diabetics with diabetic retinopathy than in those without DR or controls.
22980333 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22933291 HLA-B*81:01- but not HLA-B*39:10-mediates HIV-1 p24 sequence evolution with disease progression
22933291 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22931407 HLA-B*15:02 is associated with treatment-induced anemia in Taiwanese chronic hepatitis C patients receiving combination therapy with PEG-IFN-alpha plus ribavirin.
22925811 This study highlights that subtle sequence differences in the infection source may have profound effects on the ability to clear HCV infection in the presence of particular HLA class I alleles.
22923333 Data indicate that the peptide-loading complex (PLC) consists maximally of 2x tapasin-ERp57/MHC I per TAP complex, but one tapasin-ERp57/MHC I in the PLC is essential and sufficient for antigen processing.
22918227 This study demonstrates that natural ERAP1 polymorphism affects HLA-B27 antigen presentation and stability in vivo.
22909208 The results indicated that the prospective use of a genetic test of HLA-B*58:01 might reduce the prevalence of allopurinol-induced cutaneous adverse drug reactions
22896606 HLA-B*42:01, which presents multiple Gag epitopes, is associated with a 0.52 log(10) lower viral-load set point than HLA-B*42:02 (P = 0.02), which presents no p24 Gag epitopes.
22896606 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22887649 There is a strong epistatic interaction between HLA-B60 and HLA-B27 in ankylosing spondylitis susceptibility. As a result, individuals with the HLA-B27+/HLA-B60+ genotype are at a very high risk of developing ankylosing spondylitis.
22883001 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22844345 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22833576 Overview of evidence supporting the association of HLA-B*1502 mutation with carbemazepine-induced Stevens-Johnson syndrome, and its prevalence in Asians
22833469 A high prevalence of HLA-B27 leads to significant increases in the prevalence of axial spondyloarthritis compared to radiologic spondyloarthritis.
22826228 The relative resistance to Nef-mediated down-regulation by the cytoplasmic domains of HLA-B compared with HLA-A contributes to the better control of HIV-1 infection associated with HLA-B-restricted cytotoxic T lymphocytes.
22826228 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22818943 No significant association between HLA-B*1502 and Oxcarbazepine maculopapular eruption was found.
22818666 unique HIV-1 infected individual homozygous for CCR5-Delta32/Delta32 and carrier of HLA-A*2402 and HLA-B*5701.
22811530 analysis of HLA class I-mediated control of HIV-1 in the Japanese population, in which the protective HLA-B*57 and HLA-B*27 alleles are absent
22811521 HLA-B*57 in CD8+ T lymphocytes has a role in delaying HIV-1 disease progression
22808100 The -237A variant could represent a minor causal single nucleotide polymorphism that additionally contributes to the HLA-B*5701-mediated 'protective' effect during HIV-1 infection.
22807446 Characterization of a proteasome and TAP-independent presentation of intracellular epitopes by HLA-B27 molecules.
22795247 The data of this study suggested that CRPS with and CRPS without dystonia may be genetically different, but overlapping, disease entities because only HLA-DQ8 is associated with both.
22786832 The frequencies of HLA-DRB1*16 and HLA-DQB1*05 as well as the association HLA-DRB1*16/HLA-DQB1*05 were significantly increased in ADEM population compared to the control group.
22784404 Data suggests that HLA-B polymorphism is associated with idiopathic pulmonary fibrosis pathogenesis
22768326 Activating KIR and HLA Bw4 ligands are associated to decreased susceptibility to pemphigus foliaceus, an autoimmune blistering skin disease.
22767237 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22761389 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22718199 HLA-B position 97 is the most significant association with host control in African Americans.
22706990 Data indicate that B*44:09-derived peptides are restricted predominantly to L (Leu) or F (Phe).
22705789 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22683743 The data indicated that HLA-B*27- and HLA-B*57-restricted CD8+ T cells targeting the same epitopes in elite controllers and progressors were distinctly different, on the basis of potency and cross-reactivity of TCR recognition of HIV-1 and viral variants.
22664757 The HLA-B67 allele could be a new and important marker of Takayasu arteritis.
22651890 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22632381 The interactions between ERAP1 genetic variations and HLA-B27 play critical roles in pMHC I pathway processing contributing to the pathogenesis of Ankylosing spondylitis
22613796 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22593621 B27 H chain dimers and multimers are stronger ligands for LILRB2 than HLA class I heterotrimers and H chains
22586163 HLA-B*27, HLA-B*38, HLA-B*39 and HLA-C*12 alleles are potential psoriatic arthritis-specific genetic markers among patients with psoriasis.
22573115 when the HLA-B KIR-ligand motif is lacking, the HLA-A KIR-ligand might have a vicarious role in controlling the natural killer cell-mediated innate immune response
22572536 The expression frequencies of HLA-B*48:01 was significantly higher in the aplastic anemia group compared with those in the control group.
22553319 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22537596 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22536779 genetic polymorphism is associated with ankylosing spondylitis in three Sub-Saharan populations
22525042 These results revealed that human human macrophage MHC receptor 1 on monocytes is a novel receptor specific for HLA-B44.
22503975 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22492862 HLA-B signal peptide polymorphism influences the rate of HIV-1 acquisition but not viral load.
22489945 15 cases of somatic mutations have been reported in the HLA-A and HLA-B genes of patients with a variety of hematologic diseases, including various leukemias and non-Hodgkin's lymphoma.
22487840 Respectively 18, 33 and 13 alleles were observed at HLA-A, B and DRB1 loci.
22461701 the HLA-B7 allele is more frequently expressed in MS patients and considering that EBV is associated with MS.
22456594 Haplotype HLA-DR8 is associated with oncychomycosis in Mexican families.
22433908 This study showed that genetic background determined the inflammatory pattern (MHC class II) induced by tau neurodegenerative cascade in the transgenic rats expressing human misfolded truncated tau.
22426166 Data suggest that low level of activating KIR3DS1 and its combination with HLA-B Bw4Ile80 ligand might have an influence on the susceptibility to tuberculosis (TB) in Lur population of Iran.
22378157 [review] In this review, recommendations are provided for the use of abacavir based on HLA-B genotype.
22370889 HLA-A*11 and HLA-B*15 polymorphisms are prevalent in Mongolian and Han children with Henoch-Schonlein purpura.
22360441 The level of HLA-B27 expression in peripheral blood mononuclear cells correlates with the susceptibility to ankylosing spondylitis
22348415 This study confirmed the strong association between the HLA-B*58:01 and allopurinol-induced severe cutaneous adverse reactions in Hong Kong Han Chinese patients.
22324941 Meta-Analysis: preliminary evidence of a protective effect of HLA-B*2706 against ankylosing spondylitis.
22320938 HLA-B*07 is an allele associated with a very high risk of familial cervical cancer in a Chinese population.
22310618 There was little correlation between HLA sensitization and HLA alleles of oneself. High frequency alleles and the specificity of high-frequency HLA antibodies were not consistent.
22309845 Data indicate the association of Takayasu's arteritis (TAK) with HLA-B*52 in Turkey.
22301152 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22301137 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22298786 Role of metalloproteases in vaccinia virus epitope processing for transporter associated with antigen processing (TAP)-independent human leukocyte antigen (HLA)-B7 class I antigen presentation.
22293801 HLA-B54 and HLA-A11 were positively associated with diffuse panbronchiolitis in Northern and Southern Chinese, respectively.
22286218 Three amino acid positions (11, 71 and 74) in HLA-DRbeta1 and single-amino-acid polymorphisms in HLA-B (position 9) and HLA-DPbeta1 (position 9), all located in peptide-binding grooves, almost completely explain MHC association to rheumatoid arthritis risk.
22278241 HLA B*5701-positive long-term nonprogressors controllers are not distinguished from progressors by the clonal composition of HIV-specific CD8+ T cells.
22277675 Report PCR-RFLP genotyping assay for PSORS1C1 which is in linkage disequilibrium with HLA-B*58:01 and may be marker for allopurinol-related Stevens-Johnson syndrome/toxic epidermal necrolysis in Japanese.
22234791 This study indicates a putative association of HLA-B with moyamoya angiopathy in Caucasian patients
22225986 Studies suggest that the generation of HLA-B*27:86 was probably resulted by a point mutation while the generation of HLA-B*27:25 may have been derived from a sequence recombination event between B*46:01:01 and B*27:04:01.
22180068 distribution of HLA-B27 and CYP2D6*4 mutations in 249 patients from Tokat province in Turkey with symptoms of arthritis, sacroiliac, joint and back pain, u
22175768 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22140258 A structural basis for varied alphabeta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
22138519 analysis of HLA-B*27 in the Chinese Han population with a duplex real-time TaqMan PCR assay
22125590 Results indicate that two SNPs rs9468925 in HLA-C/HLA-B and rs2858881 in HLA-DQA2 were repeatedly selected in all models, suggesting that multiple loci outside PSOR1 locus were associated with psoriasis.
22119720 These in silico results show that the dynamic properties of peptide-MHC complexes are affected both by the bound peptide and by micropolymorphisms of the heavy chain.
22103834 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22103833 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22103831 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
22090105 HLA-B*57 micropolymorphisms have a significant impact on immune control of HIV.
22074999 Data show that the most prevalent alleles at the four loci in the black population were A*30:01, B*58:02, C*06:02, and DRB1*13:01 and in the Caucasian population were A*02:01:01, B*07:02:01, C*07:01, and DRB1*03:01.
22057263 This study found HLA-B 4601 in patients with familial myasthenia gravis.
22053601 study confirmed the association of HLA-B*1502 with carbamazepine-Steven Johnson Syndrome (CBZ-SJS) among Malaysian epilepsy patients, however there might be other genes that could be responsible for the CBZ-induced rash
22050210 Two novel alleles, HLA-B*40:125 and HLA-B*40:129, that present a mismatch at codon 103.1 (G to C), and three mismatches at codons 9.1 (C toT), 11.1 (T to G) and 12.1 (G to A), have been identified in the Brazilian population.
22042692 Data indicate that the presence of an HLA-B antigen (Ag) mismatch was significantly associated with a lower overall survival rate than an HLA-DR Ag mismatch because of an increased risk of treatment-related mortality.
22029963 A humanized anti-CD4 monoclonal antibody induces a dose-dependent down-modulation of CD4 expression on peripheral blood CD4 T cells, CD4 receptor occupancy, increases in serum CD4 complexes and CD69 upregulation on patients' T cells, but is non-depleting.
22020283 structure of a human KIR3DL1 receptor bound to HLA-B*5701 complexed with a self-peptide
22011437 There was a higher prevalence of females, uveitis, positive HLA-B27, hip prostheses and a better response to drugs in the familial ankylosing spondylitis group.
22009320 HLA-B*44:08 exhibits Q and L as anchor motif. The 45(Met/Lys) polymorphism contributes to the alteration in the peptide-binding motif.
22006856 These data support a role for the targeting of highly constrained regions by HLA-B27 in its ability to assert immune control of HCV and other highly variable pathogens.
22004234 There was no correlation between clinical features of ankylosing spondylitis and HLA-B27 subtypes.
21994772 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21993680 Amino acid position 156 is unambiguously responsible for the HLA/tapasin interaction within B*44 subtypes.
21988375 Altered PRKRA signalling and C / EBPbeta expression is associated with HLA-B27 expression in monocytic cells.
21985130 Records show that HLA-B haplotype was also increased and identified as a risk factor in Chinese patients with psoriasis.
21978000 Data show that HLA-B*5701+LTNP displayed a higher expansion ability of Gag and Nef-specific MIP(+) TNF(-) IL-2(+) T cells than HLA-B*5701-LTNP.
21963603 Data show that the missing HLA-alleles in 6pLOH(+) clones were conspicuously biased to particular alleles, including HLA-A*02:01, A*02:06, A*31:01, and B*40:02.
21929573 Frequency of HLA-A, -B and -DRB1 specificities and haplotypic associations in the population of Castilla y Leon (northwest-central Spain).
21927904 Frequency of HLA-B27 subtypes is not significantly different between ankylosing spondylitis patients and controls.
21922073 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21915505 considering the clinical importance of hypersensitivity to Abacavir in HIV patients and the frequency of HLA B*5701 carriers, we suggest the preventive use of HLA B*5701 testing in clinical practice in Abacavir treatment in Northeastern Brazil.
21906289 there is a a strong and significant association between HLA-B*5801 and allopurinol-induced Stevens Johnson syndrome and toxic epidermal necrolysis [review and meta-analysis]
21896406 work confirms the association of B*51 allele with Behcet disease (BD) in Moroccan population; a new HLA-B allele seems to play an important role in BD, the HLA-B*27 allele with a special association with uveitis
21880756 These data suggest that the selection of costly escape mutations within the immunodominant NS5B KSKKTPMGF epitope may contribute in part to the control of HCV replication in HLA-B57-positive individuals.
21876708 HLA-B57 influences the occurrence of tuberculosis in HIV infected people of south India
21872626 mismatches outside exons 2 and 3 do not alter the peptide motif of the allele group B*44:02P
21870185 No significant differences of HLA-B allelic frequencies were found between infertile patients and controls.
21861776 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21858133 Data show that HLA-A*68:02 and the B*42-C*17 haplotype in HESN partners were significantly and independently associated with faster HIV-1 acquisition.
21851420 HLA-A*11, A*31 and B*54 showed increased phenotype frequencies in polycystic ovarian syndrome women compared to controls.
21833019 Our studies have identified three specific alleles, HLA-A*33:01, HLA-B*44:03, and HLA-DRB1*07:01, to be significantly increased in vitiligo patients as compared with controls in both the initial study on North Indians.
21819546 Two novel HLA-B alleles, B*46:13:03 and B*15:189, discovered in two Taiwanese volunteer bone marrow donors, are reported.
21816002 The frequencies of human leucocyte antigen (HLA)-A, -B and -DRB1 alleles and haplotypes were statistically analysed among 3238 donors from Chinese Marrow Donor Program (CMDP) Jiangsu Branch.
21804024 These data provide the first evidence for the direct binding of KIR3DS1(+) cells to HLA-Bw4 and highlight the key role for position 138 in determining ligand specificity of KIR3DS1
21802305 [review] Higher prevalence of HLA-B 1502 allele among certain Asian populations compared to Caucasians may explain a 10-fold to 25-fold higher incidence of carbamazepine-induced Stevens-Johnson syndrome/toxic epidermal necrolysis in patients from Asia
21801394 study confirms the involvement of genetic variants located in the HLA region in the susceptibility to Stevens-Johnson syndrome/ Toxic Epidermal Necrolysis in European samples, especially in association with allopurinol induced disease and HLA-B*5801
21797986 KIR2DS1+HLA-C2 and KIR3DL1+HLA-B Bw4 Ile80 combinations were associated with the vulnerability to ankylosing spondylitis.
21778700 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21775516 HLA-B*35 might be a genetic risk factor for Dobrova virus infection in the Slovenian population.
21762823 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21742300 findings suggest that there are polymorphisms in genes of the MHC that increase susceptibility to onychomycosis
21732917 Characterization of 236 novel alleles at the HLA-A, -B, -C, -DRB1, -DQB1 and -DPB1 loci
21712058 Data show that a total of 49, 86, 50, 63, and 24 HLA-A, -B, -C, -DRB1, and -DQB1 alleles were observed.
21705835 associated with acute anterior uveitis in Asian Indian population
21699788 HLA-Cw*1202-B*5201-DRB1*1502 haplotype increases risk for ulcerative colitis but reduces risk for Crohn's disease.
21690332 In this review, KIR3DL1/S1 receptor recognition of the Bw4 epitope of HLA-A and -B antigens makes this receptor one of the most extensively studied of the variable natural killer (NK) cell receptors.
21674042 haplotypes of ORAI1 (rs12313273 and rs7135617) are associated with the risk of HLA-B27 positive ankylosing spondylitis
21671754 Review about the impact of the redox status on HLA-B27 biosynthesis and function. [Review]
21670313 Patients with HLA-B51 benefit from having multiple layers of effective defense against the development of immune escape associated with HIV-1 viral control in a Chinese cohort.
21665321 [review] Study of the HLA-B*27 subtypes complexed with 10 different peptides has already greatly added to our understanding of how these molecules can differentially influence important functional properties of the body's immune system.
21659045 This study will serve as a reference for further anthropological studies, as well as studies of HLA and disease associations in the Moroccan population.
21644226 A novel HLA-B allele was identified and has been officially named B15:129 by the WHO Nomenclature Committee
21585707 Full-length nucleotide sequences of 14 HLA-B alleles and 10 HLA-C alleles were obtained and Totally 157 and 167 polymorphism positions were found in the full-length genomic sequence of HLA-B and HLA-C loci respectively
21568943 Identification of a new HLA-B*08 allele in a family of Iraqi origin
21565792 HLA-B15 is not associated with protection from 21OH-AA formation but is associated with protection from progression to Addison disease in 21OH-AA-positive individuals.
21543478 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21533899 The associations indicate that the B 39 alleles significantly increase risk when present on specific HLA-DR/DQ haplotypes, and HLA-B typing in concert with specific HLA-DR/DQ genotypes should facilitate genetic prediction of type 1 diabetes.
21510768 Haplotype analysis revealed that HLA-B*5701 and the HCP5 rs2395029(G) allele are in complete LD (r(2) = 1) in this Mexican Mestizos sample.
21489350 Genetic variability of the IP10 gene may play a varied role depending on the inherent genetic risk of autoimmunity. IP10 (CXCL10) variability may reduce the risk of type 1 diabetes or alter its course depending on HLA background.
21482738 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21482733 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21471246 Distinct HIV-1 epitopes differentially modulated the binding of KIR3DL1 to HLA-Bw4.
21471235 Enhanced NK polyfunctionality in HIV slow progressors was dependent upon the coexpression of both KIR3DL1*h/*y and HLA-B*57.
21459456 The study suggests the possible existence of a susceptibility locus for schizophrenia within the HLA region.
21457150 Identification of a novel HLA-B*40 null allele, HLAB*40:155N
21443637 two specific amino acid changes located in the alpha 1 domain specify the novel HLA-B*27:67 allele affecting the peptide-binding-site characteristics
21422676 The relationship between positive family history and HLA-B*44 allele is significant in osteoarthritis patients living in the western Black Sea region of Turkey.
21418777 meta-analysis confirms that B*2704 might be a potential risk factor and B*2705, B*2706, B*2707 might be potential protective factors for ankylosing spondylitis in Han populations, especially in the southerners of China
21417892 The researchers evaluated the HLA-B locus and found that current Aleut populations are closer genetically to Europeans than Eskimos and Native Americans.
21414141 histidines, and in particular His116, influence the stability of MHC:peptide complexes. The conditions prevailing in inflammatory environments in vivo might thus also exert an impact on selected conformational features of HLA-B27:peptide complexes.
21388360 HLA-B*52:21 differs from the closest, HLA-B*52:01:02, by two nucleotides (CTG --> TGG), leading to an amino acid substitution from Leu to Trp at codon 156.
21388359 Identification of a novel HLA-B*35:42:02 allele in a Chinese bone marrow donor.
21360006 HLA-B27 is more frequent in male than in female patients.
21352198 Data suggest that HLA class I antigens contribute to tumour antigen-specific cellular immune response most probably by mediating the interactions between tumour cells and CD8(+) T cells.
21342137 Systemic lupus erythematosus is associated with HLA-A, HLA-B, and HLA-DRB1 alleles in Pakistani population.
21334226 Two Chinese Han cases of phenytoin-induced Stevens-Johnson syndrome with negative HLA-B*1502 allele show heterozygous HLA-B*4601/B*5102 and HLA-B*3701/B*4601 allele genotypes, respectively.
21324504 LANA1, a latent protein expressed during chronic infection to maintain a viral genome, inhibits major histocompatibility complex class I (MHC I) peptide presentation in cis as a means of immune evasion.
21302207 HLA-B27 has a positive effect in two of the most threatening human viral infections: in HIV infection, HLA-B27 positive patients have low viral loads, CD4+ T cell counts decline slowly and AIDS progresses slowly.
21280120 Analyses of the HLA-B*2705:pCAC complex by X-ray crystallography at 1.94 A resolution demonstrated that the peptide had undergone a drastic reorientation.
21248258 HLA-B27-expressing antigen-presenting cells stimulate the survival, proliferation, and IL-17 production of KIR3DL2-positive CD4 T cells.
21244392 HLA-B*1502 is strongly associated with carbamazepine-induced toxic epidermal necrolysis and Stevens-Johnson syndrome in the Malay population in Malaysia, as has been seen in Han Chinese in Taiwan.
21209113 Nef-mediated evasion of host immune responsiveness might be attributable to modulation of cell surface expression of major histocompatibility complex class I.
21209113 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21208379 A new allele, HLA-B*40:92, was identified in a north-western European subject. [HLA-B*40:92]
21165790 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21162913 The epileptic patients with carbamazepine/oxcarbazepine-induced Stevens-Johnson syndrome but not hypersensitivity syndrome are related to the HLA-B*1502 genotype.
21115737 Intracellular KIR3DL1*004 does not affect HLA-Bw4 ligand expression, nor does it exert an intracellular function by inducing a cellular stress response that might alter natural killer (NK) cell activity.
21115730 In a group of HLA-B*27-restricted HIV-infected individuals selected for slow disease progression, those with escape mutations at codon 264 of gag p24 develop higher viral loads relative to those that maintained the wild-type virus epitope.
21094798 HLA-B27 is a potential risk factor for posttransplantation diabetes mellitus in autosomal dominant polycystic kidney disease patients.
21084992 Observational study of gene-disease association. (HuGE Navigator)
21079793 Findings could be valuable for HLA matching in clinical bone marrow transplantation, HLA-linked disease-association studies, population genetics, human identification and paternity tests in forensic sciences.
21079793 Observational study of genotype prevalence. (HuGE Navigator)
21071176 In conclusion, HLA-B*1502 and other HLA alleles are not directly associated with lamotrigine-induced maculopapular exanthema.
21071176 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21068258 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
21059899 Observational study of gene-disease association. (HuGE Navigator)
21051598 genetic basis of HIV-1 control; identified >300 significant SNPs within the MHC; amino acids in HLA-B peptide binding groove and an independent HLA-C effect explain SNP associations
21051598 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21049023 Observational study of gene-disease association. (HuGE Navigator)
21040492 Observational study of gene-disease association. (HuGE Navigator)
21030096 high incidence of inferior J-waves(risk of cardiac death) in patients with HLA-B27 variation
21029668 Bw4 motifs can increase the CD4 cell count and decrease the viral load of patients with primary HIV infection.
21029668 Observational study of gene-disease association. (HuGE Navigator)
20977916 Observational study of gene-disease association. (HuGE Navigator)
20974205 Observational study of gene-disease association. (HuGE Navigator)
20970669 Observational study of gene-disease association. (HuGE Navigator)
20937338 Observational study of gene-disease association. (HuGE Navigator)
20935224 Observational study of gene-disease association. (HuGE Navigator)
20933106 Observational study of gene-disease association. (HuGE Navigator)
20931685 Observational study of gene-disease association. (HuGE Navigator)
20927388 Observational study of gene-disease association. (HuGE Navigator)
20923327 Observational study of genotype prevalence. (HuGE Navigator)
20889980 Mutational analysis reveals a complex interplay of peptide binding and multiple biological features of HLA-B27
20887224 Despite its ability to license NK cells, KIR3DL1*004/HLA-Bw4 is not associated with a reduced risk of HIV infection.
20887224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20875418 these data indicate a role of HLA-B*57-restricted CD8+ T-cell responsesin mediating spontaneous clearance and evolution in hepatitis C, nd viral strains containing epitope variants that are less recognized abrogate the protective effects of HLA-B*57.
20868574 HLA- B51 does not seem to play a dominant role in Behcet's syndrome predisposition.
20854863 Observational study of gene-disease association. (HuGE Navigator)
20851016 Observational study of gene-disease association. (HuGE Navigator)
20833111 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20810731 Protective HLA-B alleles contribute to early defects in HIV-1 fitness through the selection of detrimental mutations in Gag.
20810731 Observational study of gene-disease association. (HuGE Navigator)
20800922 Observational study of gene-disease association. (HuGE Navigator)
20798335 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20739684 Observational study of gene-disease association. (HuGE Navigator)
20727118 Identification of the novel allele HLA-B*13:01:03 by sequence-based typing method in a Taiwanese individual.
20723328 Observational study of gene-disease association. (HuGE Navigator)
20722701 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20713950 The HLA B*44 appears to influence disease course, preserving brain volume and reducing the burden of T2 hyperintense lesions in subjects with MS.
20713950 Observational study of gene-disease association. (HuGE Navigator)
20702582 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
20692483 Observational study of gene-disease association. (HuGE Navigator)
20684489 Observational study of gene-disease association. (HuGE Navigator)
20670332 Observational study of genotype prevalence. (HuGE Navigator)
20669279 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20668555 Observational study of gene-disease association. (HuGE Navigator)
20666704 Observational study of genotype prevalence. (HuGE Navigator)
20663100 A novel HLA-B allele, HLA-B*14:10, differs from HLA-B*14:08 by three nucleic acid substitutions
20660184 Observational study of gene-disease association. (HuGE Navigator)
20650849 Data show that recombinant events may occur frequently between regulatory regions and exons in most HLA-B alleles.
20637045 Observational study of genotype prevalence. (HuGE Navigator)
20636284 B*40:123 differs from the closest aligned sequence B*40: 01:01 by one nucleotide substitutions at conserved codon 20 (CCC -> TCC) resulting in an amino acid change at residue 20 (proline -> serine).
20636283 HLA-B*35:137 shows two nucleotide mismatches from HLA-B*35:01:01 at position 165 C>G and 167 A>T in exon 2, resulting in an amino acid change from Gln to Leu at codon 32.
20631027 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622878 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20613458 Observational study of gene-disease association. (HuGE Navigator)
20608062 Observational study of gene-disease association. (HuGE Navigator)
20604894 Observational study of gene-disease association. (HuGE Navigator)
20603050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20600449 Phylogenetic trees with ancestral character state reconstruction indicate that the HLA-B supertypes have multiple origins for the B07, B08, and B27 supertypes, while the B44, B58, and B62 supertypes largely form clades with a single ancestor.
20600444 Observational study of genotype prevalence. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20595679 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20595243 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
20594957 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
20588164 Observational study of gene-disease association. (HuGE Navigator)
20580654 Observational study of gene-disease association. (HuGE Navigator)
20574122 gene carrier frequency is reduced in ankylosing spondylitis patients
20574122 Observational study of gene-disease association. (HuGE Navigator)
20572892 study determined the distribution of HLA-B27 in spondyloarthritides patients of Romanian ethnicity
20572892 Observational study of gene-disease association. (HuGE Navigator)
20567513 Observational study of gene-disease association. (HuGE Navigator)
20562327 The most significant difference in PFS observed in multiple myeloma patients after autologous stem cell transplantation was with those with GR KIR3DS1(+) in whom HLA-Bw4, the ligand for the corresponding inhibitory receptor KIR3DL1, was missing
20559009 Observational study of gene-disease association. (HuGE Navigator)
20550778 genes located within the MHC class I (HLA-B27) and II (HLA-DQB1*0301) may play a role in susceptibility to Poncet's disease in patients diagnosed with TB.
20550778 Observational study of gene-disease association. (HuGE Navigator)
20549830 Observational study of gene-disease association. (HuGE Navigator)
20548248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20547426 Observational study of gene-disease association. (HuGE Navigator)
20537664 Observational study of gene-disease association. (HuGE Navigator)
20536993 Observational study of gene-disease association. (HuGE Navigator)
20536911 Observational study of gene-disease association. (HuGE Navigator)
20534626 Observational study of genetic testing. (HuGE Navigator)
20531935 HLA-B was either undetectable or very weakly expressed on all stem cells protecting them from complement-dependent cytotoxicity.
20519398 The authors show here for the first time that HLA-B*1503 is associated significantly with poor prognosis after HIV-2 infection and that HLA-B*0801 is associated with susceptibility to infection.
20519398 Observational study of gene-disease association. (HuGE Navigator)
20518846 Observational study of genotype prevalence. (HuGE Navigator)
20518845 Observational study of genotype prevalence. (HuGE Navigator)
20518835 HLA-B*5728N, differs from HLA-B*5701 because of a nucleotide substitution at position 420 (C->G) resulting in a coding change from tyrosine to a stop codon.
20517295 major causative factor of ankylosing spondylitis
20504258 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20502044 Observational study of gene-disease association. (HuGE Navigator)
20493227 Studies identified 51 A, 121 B, and 53 DRB1 alleles in Taiwanese group, and 17 A, 32 B, and 23 DRB1 alleles in Taiwanese aborigines, and findings may provide useful information in search for HLA-matched donors for patients.
20493227 Observational study of genotype prevalence. (HuGE Navigator)
20492599 Observational study of genotype prevalence. (HuGE Navigator)
20492597 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20492592 Observational study of genotype prevalence. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20478772 Observational study of gene-disease association. (HuGE Navigator)
20462405 Observational study of genotype prevalence. (HuGE Navigator)
20449807 Observational study of gene-disease association. (HuGE Navigator)
20448347 HLA-A, -B and -DRB1 alleles and haplotypes are highly polymorphic in the Miao population, and are most similar to that of the South China population.
20448347 Observational study of genotype prevalence. (HuGE Navigator)
20444482 Observational study of gene-disease association. (HuGE Navigator)
20438789 Results showed that in a Javanese population, HLA-B*1802 and HLADRB1* 1202 were the most promising candidate alleles for susceptibility and resistance to recurrent pulmonary tuberculosis, respectively.
20438789 Observational study of gene-disease association. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20422053 a novel phenomenon that distinguishes Hiv-infected individuals with the HLA-B*35-Px rapid progressing allele and those with the HLA-B*35-Py slower progressing allele
20410273 Observational study of gene-disease association. (HuGE Navigator)
20406616 ankylosing spondylitis is less common in the Icelandic population than reported in various Caucasian populations with a similar prevalence of HLA-B27
20388056 Meta-analysis of gene-disease association. (HuGE Navigator)
20385791 Observational study of gene-disease association. (HuGE Navigator)
20380698 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
20375757 analysis of the prevalence of the HLA-B*5701 allele among HIV-positive patients in Europe
20375757 Observational study of gene-disease association. (HuGE Navigator)
20374314 Observational study of gene-disease association. (HuGE Navigator)
20349238 HLA-B27(+) genetic background was not associated with susceptibility to ankylosing spondylitis. . However, TNF-alpha polymorphism, irrespective of HLA-B27, increases risk of susceptibility to ankylosing spondylitis in the general population.
20347497 Observational study of gene-disease association. (HuGE Navigator)
20345939 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20345870 Observational study of genotype prevalence. (HuGE Navigator)
20335527 HLA-B35 could contribute to endothelial cell (EC) dysfunction via endoplasmic reticulum stress-mediated induction of endothelin-1 in patients with pulmonary hypertension.
20335219 Observational study of gene-disease association. (HuGE Navigator)
20334563 in the context of HIV-1 subtype G viruses, the development of the reverse transcriptase thymadine analogue T215Y mutation may be strongly disfavored whereas the presence of HLA B*13 may counteract this effect and permit its development.
20334121 Observational study of gene-disease association. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20307907 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20235791 Common HLA-B*1502 risk allele in aromatic antiepileptic-drug induced Stevens-Johnson syndrome and toxic epidermal necrolysis in Han Chinese.
20235791 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20230525 Observational study of genotype prevalence. (HuGE Navigator)
20219611 Observational study of genotype prevalence. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20196826 Observational study of genotype prevalence. (HuGE Navigator)
20196825 Observational study of genotype prevalence. (HuGE Navigator)
20196819 HLA-B*2704 was the predominant subtype in ankylosing spondylitis patients in Southern China. B*2715 was observed in patient group only, slightly more in juvenile- than in adult-onset patients, and patients with this allele tended to have early onset.
20196819 Observational study of gene-disease association. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20169624 Observational study of gene-disease association. (HuGE Navigator)
20154067 Observational study of gene-disease association. (HuGE Navigator)
20147981 Variations in HLA-B8 is associated with non-Hodgkin lymphoma.
20147981 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20147397 Observational study of gene-disease association. (HuGE Navigator)
20145915 Observational study of gene-disease association. (HuGE Navigator)
20141578 Observational study of gene-disease association. (HuGE Navigator)
20131248 An HLA-B27 subtype-specific heavy chain flexibility may have a role in the distinct association of HLA-B27 subtypes with spondylarthritis.
20112406 peptides similar to bacterial antigens we identified may provide the missing link between bacterial infections and the resulting spondyarthritis
20097244 Observational study of genotype prevalence. (HuGE Navigator)
20090103 Observational study of gene-disease association. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
20081153 Results identify nine naturally processed HLA-B27 peptide ligands derived from six internal, not envelope, proteins of the infective human respiratory syncytial virus.
20073992 Results show presence of HLA-B*4001 and a longer duration of stavudine treatment were significantly associated with stavudine-associated lipodystrophy, whereas a higher body mass index during treatment was associated with a lower risk for lipodystrophy.
20073992 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20072141 Observational study of gene-disease association. (HuGE Navigator)
20070406 Observational study of gene-disease association. (HuGE Navigator)
20065064 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
20032191 Observational study of gene-disease association. (HuGE Navigator)
20032103 Observational study of gene-disease association. (HuGE Navigator)
20012528 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
20012522 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
20008523 HLA-B*35-Px-mediated acceleration of HIV-1 infection by increased inhibitory immunoregulatory impulses.
20003377 Observational study of gene-disease association. (HuGE Navigator)
20003137 Observational study of genotype prevalence. (HuGE Navigator)
20003135 Observational study of genotype prevalence. (HuGE Navigator)
20002212 HLA-B alleles served as the dominant MHC class I restricting molecules for anti-Mtb TB10.4-specific CD8(+) T-cell responses measured in CD8(+) T cells from patients with pulmonary tuberculosis
19968064 Observational study of gene-disease association. (HuGE Navigator)
19966201 findings show that B*2715 seems to have a special association with ankylosing spondylitis in Han Chinese patients
19965715 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19944697 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19932885 gene polymorphism is associated with keloids in chinese population
19932885 Observational study of gene-disease association. (HuGE Navigator)
19931565 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19925877 Observational study of gene-disease association. (HuGE Navigator)
19924143 Observational study of gene-disease association. (HuGE Navigator)
19920778 intralocus and interlocus comparison of mismatched HLA-A and -B specificities with corresponding recipient HLA class I type, and the number, position, and physiochemical disparity (hydrophobicity and electrostatic charge) of polymorphic amino acids
19915238 Apart from other alleles, alleles A2, and B44 play a significant role in vitiligo in the Indian patients
19915238 Observational study of gene-disease association. (HuGE Navigator)
19915237 study suggests an association between HLA-B*1502 and carbamazepine-induced Stevens-Johnson Syndrome in Indian patients
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898503 Observational study of gene-disease association. (HuGE Navigator)
19896518 Observational study of gene-disease association. (HuGE Navigator)
19895570 Observational study of genotype prevalence. (HuGE Navigator)
19879913 Observational study of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19874811 Observational study of gene-disease association. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19860590 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19847956 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19845915 Observational study of genotype prevalence. (HuGE Navigator)
19843279 Observational study of genetic testing. (HuGE Navigator)
19838694 Findings suggest that compared to HLA-B*3501, a reduced intracellular peptide repertoire for HLA-B*3503 could contribute to its slower intracellular trafficking and stronger association with rapid AIDS progression.
19834793 Observational study of gene-disease association. (HuGE Navigator)
19820376 Observational study of gene-disease association. (HuGE Navigator)
19819768 The prevalence of HLA-DQ2 and -DQ8 genes in the Libyan general population is higher than in Italy, indicating a strong genetic predisposition to CD.
19804562 HLA-B*2704 predominantly associates with ankylosing spondylitis in Chinese Han patients.
19803716 The results suggest that HLA-A*1101 may be associated with protection against while HLA-B*4006 may be associated with susceptibility to HIV and tuberculosis development in HIV patients.
19790126 strength of the association between Behcet's disease (BD) & HLA-B51/B5, and its consistency across populations of various ethnicities, lends further support to this allele being a primary and causal risk determinant for BD[review]
19775471 Observational study of gene-disease association. (HuGE Navigator)
19775371 Observational study of gene-disease association. (HuGE Navigator)
19774073 Observational study of gene-disease association. (HuGE Navigator)
19772787 Homozygosity for HLA-B27 does not affect the clinical manifestations of ankylosing spondylitis in Korean patients.
19772787 Observational study of gene-disease association. (HuGE Navigator)
19770068 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19762282 sHLA-G and sHLA-A, -B, -C serum levels were significantly elevated in HIV-infected subjects as compared with controls before antiretroviral treatment and significantly decreased after 36 months of HAART.
19758201 Studies show that HLA-B27 gene may play a role in the onset of intestinal inflammation, however, gut inflammation is not a prerequisite for the development of arthritis and spondylitis in the animal model.
19758200 Data show the usefulness of HLA-B27, rather than that of HLA-B51, in the diagnosis of ankylosing spondylitis (AS) and Behcet's disease (BD).
19750986 Observational study of gene-disease association. (HuGE Navigator)
19744147 Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1.
19735312 HLA-B*5214, a novel rare allele of HLA-B*52 variant, was found in a Taiwanese volunteer bone marrow donor by sequence-based typing method.
19731629 studies support arthritogenic peptide hypothesis for ankylosing spondylitis which envisages molecular mimicry between HLA-B27-presented foreign & self-peptides to explain cross-reactivity of autoreactive T-cells in HLA-B*2705-positive individuals
19728932 Allele HLA-B27 correlates positively with age related macular degeneration
19728932 Observational study of gene-disease association. (HuGE Navigator)
19728333 Data showed HLA-G upregulation and MHC class I downregulation in neoplastic cells.
19727231 Observational study of gene-disease association. (HuGE Navigator)
19718441 Observational study of gene-disease association. (HuGE Navigator)
19714651 The IL-23/IL-17 axis is strongly activated in the colon of B27/Hubeta(2)m-transgenic rats with spondylarthritis-like disease.
19714626 The reduced motility and viability of putatively tolerogenic CD4+ dendritic cells could play a role in initiating the inflammatory process, resulting in spondylarthritis in HLA-B27-transgenic rats.
19714482 Observational study of gene-disease association. (HuGE Navigator)
19703245 Observational study of gene-disease association. (HuGE Navigator)
19703234 Observational study of genotype prevalence. (HuGE Navigator)
19696695 A strong association of allopurinol-induced Stevens-Johnson syndrome (SJS) and toxic epidermal necrolysis (TEN) with the HLA-B*5801 allele was observed in a Thai population.
19696695 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19694795 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19693088 findings suggest a pattern of strong linkage disequilibrium consistent with an HLA-B/-C haplotype block, making identification of a causal variant difficult.
19693088 Observational study of gene-disease association. (HuGE Navigator)
19690132 Observational study of gene-disease association. (HuGE Navigator)
19684014 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19683024 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19680446 HLA-B*57 was associated with an increased risk of psoriasis and HLA-B*40 a decreased risk.
19674013 Observational study of gene-disease association. (HuGE Navigator)
19668019 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19663693 Observational study of gene-disease association. (HuGE Navigator)
19657722 The FCRL3 gene does not appear associated with susceptibility to HLA-B27-positive ankylosing spondylitis in Han Chinese population.
19655145 Observational study of gene-disease association. (HuGE Navigator)
19654877 Observational study of gene-disease association. (HuGE Navigator)
19654554 Observational study of gene-disease association. (HuGE Navigator)
19654407 Observational study of gene-disease association. (HuGE Navigator)
19653987 Observational study of gene-disease association. (HuGE Navigator)
19643141 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19630074 Carriage of the ligand of inhibitory KIR3DL1 receptor HLA-Bw4 is found to protect against multiple sclerosis in an HLA-DRB1 independent manner.
19630074 Observational study of gene-disease association. (HuGE Navigator)
19605475 Observational study of gene-disease association. (HuGE Navigator)
19589487 Observational study of gene-disease association. (HuGE Navigator)
19574026 Observational study of gene-disease association. (HuGE Navigator)
19571811 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19565552 Observational study of gene-disease association. (HuGE Navigator)
19556444 Observational study of genetic testing. (HuGE Navigator)
19555986 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19544559 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19539218 Observational study of gene-disease association. (HuGE Navigator)
19536817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536542 HLA-B*2704 is strongly associated with ankylosing spondylitis in the Wuhan population of China.
19536542 Observational study of gene-disease association. (HuGE Navigator)
19523767 The involvement of HLA-B62 and HLA-DQ8 in Complex Regional Pain Syndrome with dystonia may indicate that these HLA loci are implicated in the susceptibility or expression of the disease.
19523767 Observational study of gene-disease association. (HuGE Navigator)
19515764 These parallel in vivo and in vitro data suggest that HLA-B57 confers its advantage primarily by driving and maintaining a fitness-attenuating mutation in p24-Gag.
19502044 Observational study of gene-disease association. (HuGE Navigator)
19500315 Observational study of gene-disease association. (HuGE Navigator)
19497038 Observational study of genotype prevalence. (HuGE Navigator)
19495996 Observational study of gene-disease association. (HuGE Navigator)
19493237 Significant differences of the distribution of HLA-B*27 subtypes were found in most of the Northern and Northeastern Thais, Karens and Bamars
19493237 Observational study of genotype prevalence. (HuGE Navigator)
19493234 HLA-B contributes to the susceptibility to Japanese UC, especially cases with younger age of onset.
19493234 Observational study of gene-disease association. (HuGE Navigator)
19493233 Observational study of genotype prevalence. (HuGE Navigator)
19493232 Observational study of gene-disease association. (HuGE Navigator)
19490212 Observational study of gene-disease association. (HuGE Navigator)
19490211 Observational study of genotype prevalence. (HuGE Navigator)
19487887 This study showed that significant decressed expression of HLA-B genotypes in patients with human high-grade gliomas in Sicily.
19487887 Observational study of gene-disease association. (HuGE Navigator)
19483685 a genome-wide association (GWA) study using 866,399 markers in cases of flucloxacillin Drug-induced liver injury showed an association peak in the MHC region with the strongest association with HLA-B*5701.
19483685 Observational study and genome-wide association study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19480851 Observational study of genotype prevalence. (HuGE Navigator)
19479861 Local HLA-B27-dependent activation of peptide-specific cytotoxic CD8+ T cells by chondrocytes might contribute to inflammatory processes in the spondylarthritides.
19476482 Since B*2740 carries sequence confers to HLA-Bw6 public epitope we believe that this novel B*27 allele might have been generated from a gene conversion involving a Bw4-specific allele (probably B*2704) and a Bw6-specific allele.
19473559 Observational study of gene-disease association. (HuGE Navigator)
19473214 There is a significantly higher occurrence of HLA-DRB1*09 and HLA-B*46-DRB1*09 in patients with haemorrhagic fever with renal syndrome (HFRS) compared to the control group
19473214 Observational study of gene-disease association. (HuGE Navigator)
19460331 DNA samples from HIV-1 infected and uninfected injecting drug users (IDU) were analyzed; distribution of CCR5 and HLA-B genotypes between the two IDU groups were not statistically significant.
19449444 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19407364 Observational study of gene-disease association. (HuGE Navigator)
19405864 Observational study of gene-disease association. (HuGE Navigator)
19395541 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19392852 This is a first association study at genetic level identifying HLA-A and HLA-B-related variations in genetic susceptibility to esophageal carcinoma among Chaoshan Han population
19392852 Observational study of gene-disease association. (HuGE Navigator)
19392836 Observational study of gene-disease association. (HuGE Navigator)
19392621 Observational study of gene-disease association. (HuGE Navigator)
19364518 Observational study of genotype prevalence. (HuGE Navigator)
19364514 Observational study of genotype prevalence. (HuGE Navigator)
19362996 HLA-B*5701 was most prevalent in Caucasian population (6.5%) in Spain.
19362996 Observational study of gene-disease association. (HuGE Navigator)
19350523 Observational study of genotype prevalence. (HuGE Navigator)
19349081 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19348686 Observational study of genotype prevalence. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19318316 a polymorphism within the TNF-alpha gene at -238 play an important role in ankylosing spondylitis, although this polymorphism was not related to HLA-B27 subtypes
19317747 Observational study of genotype prevalence. (HuGE Navigator)
19307327 Observational study of gene-disease association. (HuGE Navigator)
19304978 Not all severe abacavir-induced adverse events occur as a result of classic hypersensitivity reactions, and can present also in HLA-B*5701-negative patients.
19299434 Observational study of gene-disease association. (HuGE Navigator)
19293478 No significant difference was found in the distribution of HLA-B*27 alleles between Iranian ankylosing spondylitis patients and controls.
19293478 Observational study of gene-disease association. (HuGE Navigator)
19280715 Observational study of gene-disease association. (HuGE Navigator)
19276793 Observational study of gene-disease association. (HuGE Navigator)
19275586 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19265139 Endogenous HLA-B5801 and -B5802 alloantigens in beta 2-microglobulin-defective Burkitt lymphoma Daudi cells are capable of being expressed on the tumor cell surface, although at low levels, and exclusively as immature glycoforms.
19254258 Observational study of genotype prevalence. (HuGE Navigator)
19248087 HLA-B27 positivity determined the age at ankylosing spondylitis onset. Male sex and an elevated C-reactive protein (CRP) level were associated with radiographic sacroiliitis in early stage axial spondylarthritis.
19246116 Observational study of gene-disease association. (HuGE Navigator)
19243901 The HLA-B*5701 allele is associated with abacavir hypersensitivity. Review.
19242411 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19235017 Observational study of gene-disease association. (HuGE Navigator)
19232441 Our data suggest that gene-environment interactions between specific HLA Class I loci and EBV exposure are associated with MRI markers of lesion injury and brain atrophy in MS patients.
19232441 Observational study of gene-disease association. (HuGE Navigator)
19227412 Observational study of gene-disease association. (HuGE Navigator)
19223392 Observational study of gene-disease association. (HuGE Navigator)
19221531 Observational study of gene-disease association. (HuGE Navigator)
19219503 Observational study of gene-disease association. (HuGE Navigator)
19214504 Observational study of gene-disease association. (HuGE Navigator)
19207023 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19201236 Observational study of gene-disease association. (HuGE Navigator)
19200845 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19200828 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19199259 Observational study of gene-disease association. (HuGE Navigator)
19196481 Observational study of gene-disease association. (HuGE Navigator)
19195327 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19185064 frequency of HLA-B27 alleles increases where 1) malaria is endemic, and 2) the association with Spondyloarthropathies appears as lowering
19181658 Observational study of gene-disease association. (HuGE Navigator)
19180512 Observational study of gene-disease association. (HuGE Navigator)
19169284 Observational study of gene-disease association. (HuGE Navigator)
19167761 HLA-B27 polymorphism drives the tapasin dependency, rates of intracellular maturation and expressions of homodimers.
19167759 Observational study of gene-disease association. (HuGE Navigator)
19165231 Observational study of gene-disease association. (HuGE Navigator)
19159415 Observational study of gene-disease association. (HuGE Navigator)
19155500 The binding affinity of HLA-A epitopes is significantly higher than that of HLA-B epitopes and gives rise to new hypotheses concerning the mechanisms underlying immunodominance of CD8-positive T cell responses against intracellular infectious agents.
19152094 Distribution of HLA-B27 and its alleles in patients with reactive arthritis and with ankylosing spondylitis in Tunisia is reported.
19152094 Observational study of gene-disease association. (HuGE Navigator)
19149577 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19143818 Observational study of gene-disease association. (HuGE Navigator)
19143813 Observational study of gene-disease association. (HuGE Navigator)
19143812 Observational study of gene-disease association. (HuGE Navigator)
19142234 protection from HIV disease associated with inherent host HLA B allele-mediated ability to induce broader Gag T-cell targeting coupled with apparent virological control
19140832 HLA allele and haplotype frequencies in addition to phylogenetic tree and principal component analyses based on the four-digit sequence-level allele frequencies for HLA-A, HLA-B, and HLA-DRB1 showed that Western Javanese was closest to Southeast Asians.
19140832 Observational study of genotype prevalence. (HuGE Navigator)
19139173 Major histocompatibility complex (MHC) polymorphism can alter the dynamics of the peptide-MHC landscape, resulting in fine-tuning of T cell responses between closely related allotypes.
19127112 Observational study of genotype prevalence. (HuGE Navigator)
19122146 HLA-B*0702 transgenic mice responded to influenza NP(418-426) and PB1(329-337) consistently and NP(473-481) intermittently while ligands from HA and M1 were not recognized
19116110 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19115972 Observational study of gene-disease association. (HuGE Navigator)
19109176 Prevalence of HLA-B27 ligands with dibasic N-terminal sequences is influenced by availability of cytosolically stable peptides conferring to HLA-B27 a unique capacity to present antigens generated in low amounts but resistant to intracellular degradation.
19104471 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19096254 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19091857 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
19054371 Observational study of genotype prevalence. (HuGE Navigator)
19052350 Observational study of gene-disease association. (HuGE Navigator)
19050767 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19046300 Observational study of gene-disease association. (HuGE Navigator)
19040304 HLA-B27 transgenic rats show a reduced bone mass, and suggest an involvement of the RANKL/OPG system in the mechanism of bone loss in this disease
19035480 the folding, maturation, and stability of B*1403 differ more from B*2705 than from B*1402; Thus, these features cannot account for the fact that only the 2 former allotypes are associated with ankylosing spondylitits
19032228 Observational study of gene-disease association. (HuGE Navigator)
19030725 Observational study of gene-disease association. (HuGE Navigator)
19026135 HLA-B51 (major histocompatibility complex class I B51) was significantly more common in Behects patients than in health controls
19024262 Observational study of genotype prevalence. (HuGE Navigator)
19023492 Observational study of gene-disease association. (HuGE Navigator)
19019964 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19018717 Observational study of gene-disease association. (HuGE Navigator)
19000143 Observational study of gene-disease association. (HuGE Navigator)
19000140 Observational study of genotype prevalence. (HuGE Navigator)
18991160 Aortic regurgitation was not associated with HLA-B27 in the Sami population.
18987644 Observational study of gene-disease association. (HuGE Navigator)
18982067 Data demonstrate that the influence of ZNRD1 alleles on disease progression rates are attributable to HLA-A10, help clarify the relationship between the HCP5, HLA-C and HLA-B*57 alleles, and reaffirm a critical role of HLA-B*57 alleles in HIV disease.
18982067 Observational study of gene-disease association. (HuGE Navigator)
18976440 Observational study of gene-disease association. (HuGE Navigator)
18976432 Observational study of genotype prevalence. (HuGE Navigator)
18971283 Observational study of gene-disease association. (HuGE Navigator)
18958335 Observational study of gene-disease association. (HuGE Navigator)
18953540 The clinical features of ankylosing spondylitis may be correlated with HLA-B27 status and its polymorphism.
18953540 Observational study of gene-disease association. (HuGE Navigator)
18949728 Observational study of gene-disease association. (HuGE Navigator)
18945256 Observational study of gene-disease association. (HuGE Navigator)
18941505 Across HIV Gag protein, the rise of polymorphisms from independent origin during the last twenty years of epidemic was related to an association with an HLA allele accumulated in one of either B or F subtypes
18941220 Polymorphisms outside of the Bw4 epitope, and which determine peptide binding, also alter the interaction of Bw4positive HLA-B with killer cell inhibitory receptor KIR3DL1.
18939942 Observational study of gene-disease association. (HuGE Navigator)
18925686 HLA-B*1403 is the only factor to increase the risk of AS in a sub-Saharan African population, whereas HLA-B27 was virtually absent in patients with ankylosing spondylitis
18925686 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18922348 Present results suggest that there is a significant relationship between nasal polyposis and HLA-B allele frequency among the Turkish population.
18922348 Observational study of gene-disease association. (HuGE Navigator)
18852831 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18852273 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18846964 Observational study of gene-disease association. (HuGE Navigator)
18830248 Conditional analyses on the T1DGC MHC dataset: novel associations with type 1 diabetes around HLA-G and confirmation of HLA-B are reported.
18830248 Observational study of gene-disease association. (HuGE Navigator)
18824733 Observational study of gene-disease association. (HuGE Navigator)
18824049 HLA-B23 and HLA-B46 allele are associated with severe malaria in endemic populations
18808677 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18802091 More than 1000 endogenously bound peptides have been eluted from six closely related HLA-B35 molecules, some of them representing N-terminal-extended versions of canonical peptides containing an appropriate HLA-B35 peptide motif.
18797890 Observational study of gene-disease association. (HuGE Navigator)
18795391 HLA-B27 positivity and/or M694V mutation may play a role in the development of sacroiliitis and the severity of seronegative spondyloarthropathy.
18785306 in a cohort of idiopathic juvenile arthritis,there was a higher proportion of HLA-B27-positive boys with older age at disease onset
18782112 Soluble HLA-B serum level is significantly increased in allergic rhinitis patients with pollen allergy.
18781860 Observational study of gene-disease association. (HuGE Navigator)
18778326 Observational study of gene-disease association. (HuGE Navigator)
18777204 HLA-B21 showed a significant increase in frequency in children with congenital adrenal hyperplasia-type 21-hydroxylase deficiency.
18777204 HLA-B18 showed a significant increase in frequency in children with Congenital adrenal hyperplasia -type 21-hydroxylase deficiency
18768435 Observational study of gene-disease association. (HuGE Navigator)
18765817 Observational study of gene-disease association. (HuGE Navigator)
18761557 Observational study of gene-disease association. (HuGE Navigator)
18759962 HLA-B27 heavy-chain homodimer formation can be induced by dendritic cell activation.
18725938 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18721271 HLA-A, -B and -DRB1 allele frequencies in the Bangladeshi population.
18721271 Observational study of genotype prevalence. (HuGE Navigator)
18718856 the allelic diversity in our population is similar to other Caucasian populations; however we found a series of less frequent alleles, in addition to as-yet-undescribed haplotypic associations in other populations of Caucasian origin
18718856 Observational study of genotype prevalence. (HuGE Navigator)
18718089 The gene frequency of HLA-B*13 in CML patients is significantly higher than normal people in Guangdong.
18718089 Observational study of gene-disease association. (HuGE Navigator)
18716994 Observational study of genotype prevalence. (HuGE Navigator)
18702622 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18700875 These polymorphisms composed of six haplotypes that were shared and stretched over the ethnic groups, suggesting that the susceptibility to BD was conferred by the B*510101 itself and not by any genes in linkage disequilibrium with B*510101
18700875 Observational study of gene-disease association. (HuGE Navigator)
18689790 Observational study of gene-disease association. (HuGE Navigator)
18684953 Observational study of gene-disease association. (HuGE Navigator)
18684101 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18683155 Observational study of genotype prevalence. (HuGE Navigator)
18672082 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18670229 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18668120 Observational study of gene-disease association. (HuGE Navigator)
18653452 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18646257 The aim of the study was to compare the distribution of the residues 63 and 67 on the HLA-B molecule in patients with Takayasu's arteritis and tuberculosis in order to establish a genetic relationship between these two diseases.
18646257 Observational study of gene-disease association. (HuGE Navigator)
18627572 Observational study of gene-disease association. (HuGE Navigator)
18614872 Observational study of gene-disease association. (HuGE Navigator)
18613417 Observational study of gene-disease association. (HuGE Navigator)
18596105 Observational study of gene-disease association. (HuGE Navigator)
18589099 Observational study of gene-disease association. (HuGE Navigator)
18588574 Observational study of gene-disease association. (HuGE Navigator)
18583252 Observational study of gene-disease association. (HuGE Navigator)
18582515 Observational study of gene-disease association. (HuGE Navigator)
18580606 Observational study of gene-disease association. (HuGE Navigator)
18578977 HLA-B*27/HLA-B*07 in combination with D6S273-134 allele is associated with increased susceptibility to juvenile spondylarthropathies in Croatian children.
18578977 Observational study of gene-disease association. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18544086 Observational study of gene-disease association. (HuGE Navigator)
18541215 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18521626 Observational study of gene-disease association. (HuGE Navigator)
18520158 The association of HLA-B44 alleles with idiopathic chronic urticaria (CU) suggests that there is a genetic component in the pathogenesis of CU.
18520158 Observational study of gene-disease association. (HuGE Navigator)
18517005 The significant increase of HLA-A* 26 in the BD patients without HLA-B*51 suggests that this allele itself might be one of the primary susceptibility genes involved in the development of BD independently of HLA-B*51.
18517005 Observational study of gene-disease association. (HuGE Navigator)
18505734 mutual electrostatic interactions of peptide and HLA molecule, including peptide- and subtype-dependent protonation of key residues, modulate complex stability and antigenic features of the respective HLA-B27 subtype
18505179 We demonstrated using in vitro models of immune activation that the production of interferon-gamma was specifically induced by abacavir treatment in PBMCs obtained from hypersensitive patients carrying the HLA-B*5701 allele.
18501999 Observational study of gene-disease association. (HuGE Navigator)
18497950 Abnormal expression of HLA-B is associated with regulation NF-kappaB signal pathway via regulating S100A8 in the laryngeal carcinoma
18486765 Observational study of gene-disease association. (HuGE Navigator)
18473783 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18466093 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18458507 The present study suggest that the susceptibility to advanced endometriosis, unlike in the Japanese population, is not associated with HLA-B antigens in the Korean population.
18458507 Observational study of gene-disease association. (HuGE Navigator)
18451182 Co-occurring HLA alleles across loci seem to be more important than individual allelesin squamous cell cervical cancer risk.
18451182 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18444831 Observational study of gene-disease association. (HuGE Navigator)
18438604 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18434400 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18434400 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18426680 The distribution of HLA-A, -B, -DRB1 gene of randomly selected 815 north Chinese Han population samples accorded with Hardy-Weinberg equilibrium.
18424159 Low frequency of HLA-B27 and clinical variations in ankylosing spondylitis may be due to different genetic and/or environmental factors in Turkey.
18424159 Observational study of gene-disease association. (HuGE Navigator)
18399156 Observational study of gene-disease association. (HuGE Navigator)
18396213 Observational study of gene-disease association. (HuGE Navigator)
18385790 Observational study of gene-disease association. (HuGE Navigator)
18385451 analysis of the ability of most common HLA-B alleles and HLA-A alleles with Bw4 serologic reactivity to protect target cells from lysis by KIR3DL1-dependent NK cells
18385228 while all observed R(264) mutations (K, G, Q, and T) reduced peptide binding to HLA-B27 and impaired viral replication, the replicative defects of the alternative mutants were actually less pronounced than those for R(264)K
18381784 Certain HLA alleles are found in Chinese patients with psoriasis (HLA-A*30, -Cw*06, -DR*07) and psoriatic arthritis (PsA) (HLA-B*27). Psoriasis patients with the HLA-B*27 and/or -Cw*12 may have higher risk of developing PsA.
18381784 Observational study of gene-disease association. (HuGE Navigator)
18381783 Activation of HLA-B27 promoter is a sequential event, and that TNF-alpha and IFN-beta are major participants at different timepoints.
18380778 data report distribution of the rare HLA-B*2730 allele among Croatians & the structure of the B*2730 extended haplotype
18369479 Observational study of gene-disease association. (HuGE Navigator)
18369457 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18353945 Observational study of gene-disease association. (HuGE Navigator)
18351579 Observational study of gene-disease association. (HuGE Navigator)
18347914 Observational study of gene-disease association. (HuGE Navigator)
18344933 hla-b haplotypes were associated with higer occurrence of lymphoproliferative disorders after renal transplantation
18344933 Observational study of gene-disease association. (HuGE Navigator)
18332899 Clinical trial of genetic testing. (HuGE Navigator)
18332066 Observational study of gene-disease association. (HuGE Navigator)
18329312 No significant differences were noticed in the frequencies and distribution of HLA-B27 alleles between ankylosing spondylitis patients and controls.
18329312 Observational study of gene-disease association. (HuGE Navigator)
18322308 HLA-B27 subtype B*2705 associated with ankylosing spondylitis in Iran
18322308 Observational study of gene-disease association. (HuGE Navigator)
18320121 Observational study of gene-disease association. (HuGE Navigator)
18317000 Observational study of gene-disease association. (HuGE Navigator)
18315912 Observational study of gene-disease association. (HuGE Navigator)
18309255 HLA-B27 is strongly associated with ankylosing spondylitis and identified that the major subtypes of HLA-B27 positive patients with AS in Korea are B*2705 and B*2704.
18309255 Observational study of genotype prevalence. (HuGE Navigator)
18301962 Observational study of gene-disease association. (HuGE Navigator)
18296443 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18275350 Selective targeting of CD8 T cell Env through HLA-B*5802 is associated with higher viral loads and lower CD4 counts and a lack of immune selection pressure in HIV infected persons.
18273034 Observational study of gene-disease association. (HuGE Navigator)
18256425 Observational study of gene-disease association. (HuGE Navigator)
18256392 Observational study of pharmacogenomic / toxicogenomic. (HuGE Navigator)
18248305 Observational study of gene-disease association. (HuGE Navigator)
18244920 We investigated the genetic polymorphisms of HLA-A, B, DRB1 alleles and haplotype frequencies in Mongols from Inner Mongolia, China.
18241227 Observational study of gene-disease association. (HuGE Navigator)
18240960 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18240209 HLA-B27 subtype folding is determined by the overall heavy-chain structure, since the effect of a given polymorphism depends on its structural context; Heavy chain misfolding does not explain the association of B*2707 with ankylosing spondylitis
18236804 Observational study of gene-disease association. (HuGE Navigator)
18203313 HLA-B27 is not associated with joint pain after Campylobacter; A significant association between HLA-B27 and severity of joint pain was observed after gastrointestinal infections
18192896 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18190553 Meta-analysis of gene-disease association. (HuGE Navigator)
18186801 In this study, samples from 95 SARS patients and 403 healthy controls were typed for HLA-A, -B and -DRB1 alleles and no association was found between HLA variations and SARS.
18186801 Observational study of gene-disease association. (HuGE Navigator)
18186795 Study reports a newly discovered allele B*480102, a variant of B*4801, detected in a 55-year-old Taiwanese patient of Minan origin (southern China).
18178223 Certain HLA-B27 subtypes are associated with ankylosing spondylitis e.g. HLA-B*2705, while others e.g.HLA-B*2709 are not; the difference correlates with an opening of the HLA-B*2705 binding groove and a partial detachment of the C-terminal peptide anchor.
18158593 Observational study of gene-disease association. (HuGE Navigator)
18158593 Our results indicate that the major susceptibility gene for BD is HLA-B*51 and that the association between MICA*009 and BD arises from a strong linkage disequilibrium with HLA-B*51.
18155264 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18097038 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18093280 Observational study of gene-disease association. (HuGE Navigator)
18088468 HLA-B*5501 gene may be considered as a risk marker of aplastic anemia.
18088468 Observational study of gene-disease association. (HuGE Navigator)
18086267 Observational study of genotype prevalence. (HuGE Navigator)
18082573 Observational study of genotype prevalence. (HuGE Navigator)
18074415 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18070207 Observational study of gene-disease association. (HuGE Navigator)
18065518 Observational study of gene-disease association. (HuGE Navigator)
18064508 polymorphisms in some alleles of B and C in HLA class I genes are associated with Kawasaki disease in Korean children.
18064508 Observational study of gene-disease association. (HuGE Navigator)
18057683 Observational study of gene-disease association. (HuGE Navigator)
18057683 immunoglobulin A deficiency in Polish population is strongly associated with HLA-B*08:DRB1*03 haplotype rather than with single alleles
18057255 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18036353 High molecular weight B27 is characterized by high secondary structural content, structural stability, stability to proteolysis by trypsin, and structural features that are both partly native-like, and partly non-native-like.
18022727 Observational study of gene-disease association. (HuGE Navigator)
18007983 Observational study of gene-disease association. (HuGE Navigator)
18007983 The allele HLA-B*1301 is strongly associated with TCE-induced hypersensitivity dermatitis among exposed workers in China.
18005690 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18005680 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
18004301 pinpoint disease susceptibility to the MHC class I genes HLA-B and HLA-A, in addition to the established associations of the MHC class II genes
18001299 existence of a small, discrete group of HLA-B27 promoters, potentially able to mitigate the deleterious effect of this allele, has not been confirmed
18001297 Observational study of genotype prevalence. (HuGE Navigator)
17999652 Amino acid substitution at residue 156 of HLA-B alleles is shown to be important for T-cell recognition of other HLA molecules, such as HLA-B44 subtypes in transplantation.
17997746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17990989 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17989838 Observational study of gene-disease association. (HuGE Navigator)
17989341 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17982707 Male gender and the spondylitis subgroup were statistically associated to the positive HLA-B27, and the oligoarthritis subgroup was associated to the negative HLA-B27 in psoriatic arthritis in Brazil
17982707 Observational study of gene-disease association. (HuGE Navigator)
17971052 Observational study of gene-disease association. (HuGE Navigator)
17964196 Observational study of gene-disease association. (HuGE Navigator)
17961775 Observational study of genotype prevalence. (HuGE Navigator)
17956696 Observational study of genotype prevalence. (HuGE Navigator)
17934211 Expression of proteins from arthritogenic bacteria in HLA-B27-positive human cells allows identifying bacterial peptides that are endogenously processed and presented by HLA-B27.
17929129 HLA-B27 has a role in Beta 2-microglobulin amyloid deposit, as shown in transgenic rats
17927716 Observational study of gene-disease association. (HuGE Navigator)
17924859 Observational study of gene-disease association. (HuGE Navigator)
17924859 The A1-B8 haplotype hitchhiking with the hemochromatosis C282Y mutation was not associated with a more efficient iron absorption
17922429 results suggest that HLA genotype relates to the muscular necrosis and the pathogenesis of Duchenne muscular dystrophy
17922429 Observational study of gene-disease association. (HuGE Navigator)
17922417 a novel HLA allele in Chinese population
17922415 a novel HLA-B allele, officially named HLA-B*5618
17911430 Observational study of gene-disease association. (HuGE Navigator)
17911426 Sera from patients with ankylosing spondylitis show complement-dependent cytopathic activity against sheep red cells coated with HLA-B27 peptide antigens
17909631 Observational study of gene-disease association. (HuGE Navigator)
17908086 Observational study of gene-disease association. (HuGE Navigator)
17907045 Observational study of gene-disease association. (HuGE Navigator)
17900288 Observational study of genotype prevalence. (HuGE Navigator)
17892322 Mycobacterium tuberculosis-specific CD8(+) T cells are found in high frequency in infected individuals and are restricted predominantly by HLA-B alleles.
17891921 Observational study of genotype prevalence. (HuGE Navigator)
17885623 Observational study of genotype prevalence. (HuGE Navigator)
17878955 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17869653 Observational study of genotype prevalence. (HuGE Navigator)
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17825227 HLA-A * 02, HLA-B * 58 and HLA-DRB1 * 03 might be the susceptible genes of NPC patients while HLA-B * 40 might be the protective gene of NPC patients.
17825227 Observational study of gene-disease association. (HuGE Navigator)
17785583 Observational study of gene-disease association. (HuGE Navigator)
17767551 results strongly imply that the HLA-B8, -DRB1*0301, -DQB1*0201 haplotype genetically & primarily determines predisposition to sarcoidosis in the Croatian population.
17767549 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17767549 study examined whether predisposition to HPV 16/18-related cervical cancer because of p53 proline homozygosity among Indian women was mediated singly or jointly with immunogenetic risk factors such as HLA-B*07 or homozygosity of HLA-DQB1*03
17763415 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17726164 Observational study of gene-disease association. (HuGE Navigator)
17717670 in the HLA-B(major histocompatibility complex class I B) 27 positive patients with RS in this study there was predominance of HLA-B 2705 allele
17717670 Observational study of gene-disease association. (HuGE Navigator)
17715334 Observational study of gene-disease association. (HuGE Navigator)
17665395 Observational study of gene-disease association. (HuGE Navigator)
17665395 Genes mapping in the HLA region have an HLA-B27-independent role in susceptibility to ankylosing spondylitis.
17662350 Observational study of gene-disease association. (HuGE Navigator)
17662350 frequency of HLA antigens was significantly increased suggesting that brain cavernoma susceptibility may be associated with HLA antigens
17661908 Observational study of gene-disease association. (HuGE Navigator)
17657677 The novel -646A TNFalpha allele was associated with the expression of HLA-B51 in Korean Behcet disease, although no genetic role of TNFalpha promoter polymorphisms was found in the susceptibility to Behcet's disease.
17652849 Observational study of gene-disease association. (HuGE Navigator)
17641165 Observational study of gene-disease association. (HuGE Navigator)
17632570 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17632197 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17629023 Observational study of gene-disease association. (HuGE Navigator)
17610418 Observational study of genotype prevalence. (HuGE Navigator)
17609824 Observational study of gene-disease association. (HuGE Navigator)
17604883 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17604825 Observational study of gene-disease association. (HuGE Navigator)
17603847 Observational study of gene-disease association. (HuGE Navigator)
17597093 evidence of a primary association of HLA-C, and to a lesser extent HLA-B, with Graves' disease
17594535 did not observe any association in between HLA-B51 gene, its polymorphism, expression and Denizli Province patients
17586554 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17586321 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17584771 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17581864 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17580542 polymorphism, evolution, distribution and current pathogenetic hypotheses are presented [review]
17578051 Observational study of gene-disease association. (HuGE Navigator)
17573956 Observational study of gene-disease association. (HuGE Navigator)
17554059 Observational study of gene-disease association. (HuGE Navigator)
17551464 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17551464 phenomenon of strong association between the HLA B14 allele and the CYP21 V281L mutation found in this congenital adrenal hyperplasia population study can be used to distinguish between homozygote and hemizygote carrying the V281L mutation
17546694 Observational study of gene-disease association. (HuGE Navigator)
17538887 Observational study of gene-disease association. (HuGE Navigator)
17523949 Observational study of gene-disease association. (HuGE Navigator)
17509453 Observational study of genotype prevalence. (HuGE Navigator)
17509004 Observational study of gene-disease association. (HuGE Navigator)
17504510 Observational study of genotype prevalence. (HuGE Navigator)
17498269 Observational study of gene-disease association. (HuGE Navigator)
17493347 Observational study of genotype prevalence. (HuGE Navigator)
17493332 Observational study of gene-disease association. (HuGE Navigator)
17491685 Meta-analysis of gene-disease association. (HuGE Navigator)
17489060 Observational study of gene-disease association. (HuGE Navigator)
17487448 Observational study of gene-disease association. (HuGE Navigator)
17487448 Increased frequency of HLA A2, A11, and B35 alleles in unselected pediatric Henoch Schonlein purpura patient population may be a risk factor for susceptibility.
17480220 Observational study of gene-disease association. (HuGE Navigator)
17479950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17472990 Observational study of gene-disease association. (HuGE Navigator)
17471440 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17462513 Observational study of gene-disease association. (HuGE Navigator)
17462513 Study suggests a difference in the distribution of HLA-B alleles in patients with takayasu arteritis and tuberculosis.
17462512 Observational study of genotype prevalence. (HuGE Navigator)
17462512 The genetic distance (GD) estimated according to HLA-A, -B, and -C allele frequency indicates that Mongolian and Hui have the closest relationship.
17462511 Observational study of genotype prevalence. (HuGE Navigator)
17462508 A new human leukocyte antigen (HLA) allele, named B*1576, was identified.
17460569 Observational study of genotype prevalence. (HuGE Navigator)
17458393 Observational study of gene-disease association. (HuGE Navigator)
17437273 Observational study of gene-disease association. (HuGE Navigator)
17433060 Observational study of gene-disease association. (HuGE Navigator)
17429413 Observational study of gene-disease association. (HuGE Navigator)
17428358 Observational study of gene-disease association. (HuGE Navigator)
17416294 Observational study of gene-disease association. (HuGE Navigator)
17416294 The only allele conferring risk to ankylosing spondylitis expression in Israeli Jews was B( *)2702, as was previously described in Mexican Mestizos.
17392574 Observational study of gene-disease association. (HuGE Navigator)
17389028 analysis of the novel HLA-B*5813 allele which is identical to HLA-B*5801, except for a nucleotide substitution that changes GAG to AAG at codon 128, resulting in an amino acid change from glutamic acid to lysine in the protein
17389027 analysis of a novel human leukocyte antigen (HLA)-B*56 allele, B*5618 and an extension of B*2736 that were found during routine high-resolution sequence-based typing in a Chinese Han individual
17389026 the novel HLA-B*9518 allele is identical to B*150101 with an exception of one base substitution at position 19 of exon 3 where a 'G' change to 'T' resulting in codon 97 changed from AGG (Arg) to ATG (Met)
17389025 HLA-B*350802 is a novel allele which has arisen by silent mutation at codon 67
17383044 Observational study of gene-disease association. (HuGE Navigator)
17378697 Observational study of gene-disease association. (HuGE Navigator)
17373939 Observational study of genotype prevalence. (HuGE Navigator)
17357107 MHC micropolymorphism of HLA-B at positions outside the primary anchor residue binding pockets can have a major influence on determinant selection in antiviral T cell responses.
17356469 Prospective screening for HLA-B*5701 avoids abacavir hypersensitivity reaction in the ethnically mixed French HIV population.
17349873 HLA-B35 regulates apoptosis in human mononuclear blood cells and transfected mouse fibroblasts in a haplotype-specific manner.
17317585 Observational study of gene-disease association. (HuGE Navigator)
17311253 Observational study of gene-disease association. (HuGE Navigator)
17306585 Observational study of genotype prevalence. (HuGE Navigator)
17304884 Observational study of gene-disease association. (HuGE Navigator)
17294180 Examination of the peptide-binding specificity of HLA-B*41 alleles.
17288808 Observational study of genotype prevalence. (HuGE Navigator)
17284227 Observational study of gene-disease association. (HuGE Navigator)
17258541 Observational study of gene-disease association. (HuGE Navigator)
17257318 Observational study of genotype prevalence. (HuGE Navigator)
17251285 Observational study of gene-disease association. (HuGE Navigator)
17251285 are consistent with data from studies of other HLA-class I alleles associated with HIV control that have shown that the targeting of multiple Gag epitopes is associated with relative suppression of viremia.
17251285 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17240790 There is a positive association between HLA-B18 antigen and tuberculosis, while HLA-B7 and HLA-B61(40) antigens seem to protect against the disease.
17234427 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17227111 Observational study of gene-disease association. (HuGE Navigator)
17215337 Observational study of gene-disease association. (HuGE Navigator)
17212710 Observational study of genotype prevalence. (HuGE Navigator)
17212707 Observational study of gene-disease association. (HuGE Navigator)
17209778 Observational study of gene-disease association. (HuGE Navigator)
17209778 HLA-B*15 was a significant risk factor for generalized aggressive periodontitis and was positively correlated with the disease. severity.
17207712 Observational study of gene-disease association. (HuGE Navigator)
17197814 Observational study of gene-disease association. (HuGE Navigator)
17186951 Observational study of gene-disease association. (HuGE Navigator)
17170457 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17117954 Observational study of genotype prevalence. (HuGE Navigator)
17106278 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17101473 Observational study of gene-disease association. (HuGE Navigator)
17085834 Observational study of gene-disease association. (HuGE Navigator)
17082617 Basic immunological features are shared by B*2704 and B*2705, the two major HLA-B27 allotypes associated with ankylosing spondylitis in human populations.
17077296 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
17062033 Observational study of gene-disease association. (HuGE Navigator)
17055360 Observational study of gene-disease association. (HuGE Navigator)
17026471 Observational study of genotype prevalence. (HuGE Navigator)
17021858 We here describe the identification of the novel allele HLA-B*3565Q.
17021767 Observational study of gene-disease association. (HuGE Navigator)
17021767 Results for antigens and allele frequency of various HLA Loci in vitiligo patients and control subjects suggested that HLA-B7, Bw6, Cw6, Cw7, and DRB4*010101 could be susceptible to vitiligo.
17006990 German patients were distinct from Italian and North American patients with respect to DQ2 and from the North American patients with respect to B8-DR3-DQ2 HLA in autoimmune hepatitis (AIH) type 1 [HLA-B8].
17003171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16981842 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16981842 genotyped the HLA-B alleles in 56 Caucasian patients with varying severities of carbamazepine hypersensitivity
16960807 A statistically significant HLA-B maternal-fetal genotype-matching effect on schizophrenia was demonstrated for female offspring (P=.01; parameter estimate 1.7 [95% confidence interval 1.22-2.49]).
16926287 Observational study of gene-disease association. (HuGE Navigator)
16922942 Observational study of gene-disease association. (HuGE Navigator)
16893385 The data indicated a high degree of haplotypic diversity and strong linkage disequilibrium between MICA-STR and HLA-B in a southern Chinese Han population
16890179 Observational study of gene-disease association. (HuGE Navigator)
16883565 Observational study of genotype prevalence. (HuGE Navigator)
16883542 Observational study of genotype prevalence. (HuGE Navigator)
16883538 Data show that HLA-B27 was significantly relative to ankylosing spondylitis and the increased frequency of MICA alleles may be due to its strong linkage disequilibrium with HLA-B27.
16883538 Observational study of gene-disease association. (HuGE Navigator)
16870575 Observational study of genotype prevalence. (HuGE Navigator)
16866886 Observational study of genotype prevalence. (HuGE Navigator)
16866885 Observational study of genotype prevalence. (HuGE Navigator)
16866883 Observational study of genotype prevalence. (HuGE Navigator)
16857416 Observational study of gene-disease association. (HuGE Navigator)
16856341 HLA-B gene was highly polymorphic among Chinese northern Hans.
16829309 Observational study of genotype prevalence. (HuGE Navigator)
16758424 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16733912 Observational study of genotype prevalence. (HuGE Navigator)
16720216 Observational study of gene-disease association. (HuGE Navigator)
16720213 Observational study of gene-disease association. (HuGE Navigator)
16720212 Observational study of gene-disease association. (HuGE Navigator)
16704965 Observational study of gene-disease association. (HuGE Navigator)
16698437 Observational study of genotype prevalence. (HuGE Navigator)
16677075 analysis of HLA-B2704 and HLA-B2705 in lymphoblastoid and transfected adherent cells
16671949 Observational study of gene-disease association. (HuGE Navigator)
16671946 Observational study of gene-disease association. (HuGE Navigator)
16609350 Observational study of gene-disease association. (HuGE Navigator)
16604503 Observational study of genotype prevalence. (HuGE Navigator)
16563877 The association of the HLA-B51 and HLA-B52 alleles with pulmonary tuberculosis in HIV-positive and HIV-negative patients and in healthy subjects is reported.
16542878 Observational study of gene-disease association. (HuGE Navigator)
16538176 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16538176 Authors suggest that HLA-B*1502 could contribute to the pathogenesis of CBZ-SJS/TEN, and that genetic susceptibility to CBZ-induced cADRs is phenotype-specific.
16537577 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16532100 Observational study of gene-disease association. (HuGE Navigator)
16511245 analysis of crystals from the human major histocompatibility antigen HLA-B*2706 in complex with a viral peptide and with a self-peptide
16511201 X-ray diffraction analysis of crystals from the recombinantly expressed human major histocompatibility antigen HLA-B*2704 in complex with a viral peptide and with a self-peptide
16508981 Observational study of gene-disease association. (HuGE Navigator)
16496287 Observational study of gene-disease association. (HuGE Navigator)
16493052 Tyrosine320 of HLA-B27 is most likely part of a cytoplasmic sorting motif involved in spontaneous endocytosis and shedding of histocompatbility class I molecules.
16473309 Observational study of genotype prevalence. (HuGE Navigator)
16463424 Observational study of gene-disease association. (HuGE Navigator)
16459714 Intrathecal production and fluctuations in CSF and serum concentrations of sHLA-I were reciprocal in multiple sclerosis.
16456803 Observational study of genotype prevalence. (HuGE Navigator)
16456797 Observational study of genotype prevalence. (HuGE Navigator)
16456786 Observational study of genotype prevalence. (HuGE Navigator)
16451204 Observational study of genotype prevalence. (HuGE Navigator)
16451199 Observational study of genotype prevalence. (HuGE Navigator)
16451198 Observational study of genotype prevalence. (HuGE Navigator)
16441499 HLA-B*1586 is a novel, hybrid HLA-B15/B22 allele with unique serology and haplotypic association
16441498 Identification of HLA-B*4905
16441497 Characterization of the novel allele HLA-B*3710
16441496 A novel identification of HLA-B*07 allele, HLA-B*0743
16441486 Observational study of genotype prevalence. (HuGE Navigator)
16441486 Gene frequencies and haplotypic associations within HLA-A loci were determined at a high-resolution allelic level and should provide useful information in anthropology, bone marrow donor registry, legal medicine, and disease association studies.
16439971 Observational study of gene-disease association. (HuGE Navigator)
16426242 For HLA class I antigens, HLA-B13 frequency was marginally increased in patients with RHD compared to controls without reaching statistical significance.The HLA-DRB1*13, DRB5* and DRB3* were protective against the development of rheumatic valve damage.
16405603 Observational study of gene-disease association. (HuGE Navigator)
16386651 Observational study of genotype prevalence. (HuGE Navigator)
16386647 Observational study of gene-disease association. (HuGE Navigator)
16365741 Observational study of gene-disease association. (HuGE Navigator)
16365153 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
16361713 Observational study of gene-disease association. (HuGE Navigator)
16343061 Observational study of gene-disease association. (HuGE Navigator)
16337001 Observational study of genotype prevalence. (HuGE Navigator)
16331567 HLA-B allele frequency distributions were consistent with the Hardy-Weinberg equilibrium in a group of indigenous Hans in Shenyang, China.
16331567 Observational study of genotype prevalence. (HuGE Navigator)
16331510 We found limited associations between HLA class I gene polymorphisms and Th2-like (IL-4) immune responses after measles vaccination, indicating that HLA class I molecules may have a limited effect on measles-vaccine-induced IL-4 secretion.
16305683 Observational study of genotype prevalence. (HuGE Navigator)
16297191 Observational study of gene-disease association. (HuGE Navigator)
16291075 Observational study of gene-disease association. (HuGE Navigator)
16272310 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
16267409 Observational study of gene-disease association. (HuGE Navigator)
16226813 MHC class I glycoproteins may regulate the immune response by modulating the expression and function of other genes, whose products are essential for proper antigen processing and presentation.
16221670 conformational dimorphisms of MHC class I-bound peptides might be connected with the occurrence of self-reactive cytotoxic T lymphocytes
16216678 Observational study of genotype prevalence. (HuGE Navigator)
16215957 The HLA-A,-B,-DRB1 distribution in Shanxi Han population shares some genetic characteristics with other Han populations in northern part of China, but it exhibits its own characteristics.
16215957 Observational study of genotype prevalence. (HuGE Navigator)
16215732 Observational study of genetic testing. (HuGE Navigator)
16212528 Observational study of gene-disease association. (HuGE Navigator)
16206270 Observational study of gene-disease association. (HuGE Navigator)
16200572 12% AND 13% postive in psoriatic arthritis in Sardinia and Italy
16188571 Observational study of gene-disease association. (HuGE Navigator)
16188571 HLA-B7 is associated with the development of breast cancer
16185849 Observational study of gene-disease association. (HuGE Navigator)
16185849 The HLA-A*02 and -A*03 were observed increased frequencies in patients less than 50% hair loss, and HLA-B*27 equally in patients of 50-99% hair loss, alopecia totalis and alopecia universalis.
16185329 Observational study of gene-disease association. (HuGE Navigator)
16185325 Observational study of genotype prevalence. (HuGE Navigator)
16177631 Mismatches at the HLA-B locus, but not at the HLA-A or HLA-DR loci, and anti T-cell antibody therapy were both independently associated with development of posttransplant lymphoproliferative disease
16174649 Observational study of gene-disease association. (HuGE Navigator)
16173256 Observational study of gene-disease association. (HuGE Navigator)
16143070 HLA-B38 alleles in Han population, Gansu province seem to contribute to the genetic susceptibility, while HLA-A11 and -DR03 alleles to the genetic resistance, to leukemia.
16143070 Observational study of gene-disease association. (HuGE Navigator)
16134731 Observational study of gene-disease association. (HuGE Navigator)
16133177 Observational study of gene-disease association. (HuGE Navigator)
16129034 Observational study of gene-disease association. (HuGE Navigator)
16120569 Observational study of genotype prevalence. (HuGE Navigator)
16115862 HLA-B14 subtypes (B*1402 and B*1403) differentially associated with ankylosing spondylitis differ substantially in peptide specificity but have limited peptide and T-cell epitope sharing with HLA-B27
16103458 Observational study of gene-disease association. (HuGE Navigator)
16101835 a new HLA-B allele, B*5615, has been identified in a Caucasian individual by sequence-based typing
16101833 Observational study of genotype prevalence. (HuGE Navigator)
16101830 Observational study of gene-disease association. (HuGE Navigator)
16091223 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
16086295 Guangdong Han population in China has twelve HLA-A, 23 B, 11 Cw and 13 DRB1 alleles and a total of 9 HLA-A-B, 20 Cw-B, 7 A-Cw, and 8 A-DRB1, 9 B-DRB1, 10 Cw-DRB1 haplotypes.
16086294 In a northwest Chinese Han population, fifteen alleles for the locus HLA-A, 28 alleles for the HLA-B locus and 13 alleles for the HLA-DRB1 were detected. The results showed that the most frequent HLA alleles found were A02, B13, and DRB1*15.
16081817 HLA-B alleles which may share HLA-B*5703 peptide-binding specificity may have the capacity to present overlapping peptide repertoires that may implicate them in long-term nonprogression of HIV infection.
16053028 Observational study of gene-disease association. (HuGE Navigator)
16032389 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16029431 Observational study of genetic testing. (HuGE Navigator)
16019679 HLA class I and class II genes do not contribute to susceptibility to HAU.
15994556 findings showed that Kaposi's sarcoma-associated herpesvirus MIR1 promoted down-regulation of HLA-B7 molecules lacking lysine residues in their intracytoplasmic domain
15982506 Gene expression analysis of giant cell myocarditis offers novel insights into its pathogenesis, namely the role of T-cell activators of the Th1 subset and immune response genes previously implicated in heart failure.
15982261 analysis of novel HLA-B*5517 allele
15982260 analysis of the new HLA-B*0739 and its alloreactivity when mismatched with HLA-B*0702
15982258 new HLA class I alleles found in Caucasian population: A*3012, B*270505, B*3541 and Cw*0716
15982257 genetic analysis of HLA-B27 polymorphism in Mumbai, Western India
15982254 Observational study of genotype prevalence. (HuGE Navigator)
15975271 Observational study of gene-disease association. (HuGE Navigator)
15952133 The HLA-B loci are highly polymorphic in Monba population of Xizang Autonomous Region. Compared with other ethnic groups in China, the Monba ethnic group is close to Tibetan ethnic group.
15949652 Observational study of gene-disease association. (HuGE Navigator)
15942906 The human leukocyte antigen-Bw4I80 epitope and the KIR3DS1 gene were more frequent in HCV carriers than in patients with hepatocellular carcinoma, and the associations were not independent of each other.
15935892 Exons 1, 4, and 5 sequences of 39 different HLA-B alleles were elucidated by allele-specific sequencing, and the polymorphism observed in these exons merely reflects the lineage-specificity of HLA-B.
15932368 Observational study of gene-disease association. (HuGE Navigator)
15902698 Observational study of gene-disease association. (HuGE Navigator)
15896210 identification of novel allele HLA-B*1586*
15896200 analysis of coding sequences and haplotypic associations of HLA-B and HLA-DRB1 and association to HLA-DRB3 and HLA-DRB4 loci
15878340 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
15858601 Observational study of gene-disease association. (HuGE Navigator)
15854903 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
15854279 Observational study of genotype prevalence. (HuGE Navigator)
15854278 Observational study of gene-disease association. (HuGE Navigator)
15854032 Observational study of gene-disease association. (HuGE Navigator)
15853908 A new allele, HLA-B*5514 differs in 6 positions (360, 361, 369, 412, 419, and 527)in exon 3 from HLA-B*5612. 4 AA substitutions in exon 3 ar: Arg121Val, Asn138Asp, Tyr140Ser, Val176Glu
15853907 Compared to B*070201, B*0734 differs at four nucleotide positions, 412 (G-->A), 539 (G-->T), 559 (G-->A) and 560 (A-->C) causing three amino acid substitutions, at postion 138 Asp-->Asn, at position 180 Arg-->Leu and at position 187 Glu-->Thr.
15853906 HLA-B*1585 differs from HLA-B*15010101 at 5 bases in exon 3 causing 3 AA changes at 94 (Thr-->Ile), 95 (Leu-->Ile) & 103 (Val-->Leu). HLA-B*1587 differs from HLA-B*15010101 at codons 80-83 (Asn-Leu-Arg-Gly-->Ile-Ala-Leu-Arg) replaced by HLA-Bw4 motif.
15853905 A new allele, B*5206, differs from HLA-B*520102 by 1 nucleotide exchange in exon 2 at nucleotide position 274.Substituting T for C leads to an amino acid change at protein position 67 from serine (TCC) to phenylalanine (TTC).
15853903 Observational study of gene-disease association. (HuGE Navigator)
15853898 Observational study of genotype prevalence. (HuGE Navigator)
15836703 Observational study of gene-disease association. (HuGE Navigator)
15807454 Observational study of gene-disease association. (HuGE Navigator)
15793795 The distribution of HLA-A, -B allele polymorphism in the Luoba nationality is distinctive, but some of the gene distribution in the Luoba group is nearer to that in the Tibetan group.
15793795 Observational study of genotype prevalence. (HuGE Navigator)
15784468 Observational study of gene-disease association. (HuGE Navigator)
15784466 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15743917 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15740492 Observational study of gene-disease association. (HuGE Navigator)
15728986 Observational study of gene-disease association. (HuGE Navigator)
15728986 A study evaluating the associations between HLA alleles and the severity of malaria in a Thai population, polymorphisms of HLA-B and HLA-DRB1 genes were investigated in 472 adult patients in northwest Thailand with P. falciparum malaria.
15726104 Observational study of gene-disease association. (HuGE Navigator)
15683420 Observational study of gene-disease association. (HuGE Navigator)
15666025 Observational study of genotype prevalence. (HuGE Navigator)
15665390 Observational study of gene-disease association. (HuGE Navigator)
15665390 HLA B-27 may have a role in spondyloarthropathy as seen by genotypic analysis of Turkish patients
15662734 Observational study of gene-disease association. (HuGE Navigator)
15652424 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15641063 Observational study of gene-disease association. (HuGE Navigator)
15640334 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15638726 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
15631661 Observational study of genotype prevalence. (HuGE Navigator)
15621102 Observational study of genotype prevalence. (HuGE Navigator)
15613143 Observational study of gene-disease association. (HuGE Navigator)
15611225 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
15609316 HLA-B8-presented HPV16 E7 epitope is recognized by T cells from patients with cervical cancer
15607698 Observational study of gene-disease association. (HuGE Navigator)
15603879 Observational study of gene-disease association. (HuGE Navigator)
15603872 Observational study of gene-disease association. (HuGE Navigator)
15602199 Observational study of gene-disease association. (HuGE Navigator)
15585327 Residues at positions 63 (glutamic acid) and 67 (serine) of the HLA-B molecule could be the genetic markers for Takayasu's arteritis.
15567775 Observational study of genetic testing. (HuGE Navigator)
15555263 Observational study of genotype prevalence. (HuGE Navigator)
15554365 Observational study of gene-disease association. (HuGE Navigator)
15546341 Observational study of genotype prevalence. (HuGE Navigator)
15534563 Observational study of genotype prevalence. (HuGE Navigator)
15533584 Observational study of gene-disease association. (HuGE Navigator)
15498100 Observational study of genotype prevalence. (HuGE Navigator)
15496201 Observational study of genotype prevalence. (HuGE Navigator)
15494511 Crystal structures of HLA-B*3501 in complex with 14-mer macrophage-colony stimulating factor peptide reveal that the antigenic peptide follows the general rules of major histocompatibility complex binding.
15491536 Observational study of gene-disease association. (HuGE Navigator)
15480178 Observational study of gene-disease association. (HuGE Navigator)
15471368 Observational study of gene-disease association. (HuGE Navigator)
15386946 Observational study of gene-disease association. (HuGE Navigator)
15362660 Observational study of gene-disease association. (HuGE Navigator)
15361135 Observational study of genotype prevalence. (HuGE Navigator)
15361126 Observational study of genotype prevalence. (HuGE Navigator)
15336784 Observational study of genetic testing. (HuGE Navigator)
15323271 Observational study of gene-disease association. (HuGE Navigator)
15323271 HLA antigens might affect the prognosis in lung cancer.
15321756 Observational study of genotype prevalence. (HuGE Navigator)
15307911 Observational study of gene-disease association. (HuGE Navigator)
15307871 Observational study of gene-disease association. (HuGE Navigator)
15304011 Observational study of gene-disease association. (HuGE Navigator)
15304010 Observational study of genetic testing. (HuGE Navigator)
15304009 Observational study of genotype prevalence. (HuGE Navigator)
15301866 Observational study of gene-disease association. (HuGE Navigator)
15301865 Observational study of gene-disease association. (HuGE Navigator)
15301245 Observational study of genotype prevalence. (HuGE Navigator)
15275783 Observational study of gene-disease association. (HuGE Navigator)
15247625 Observational study of gene-disease association. (HuGE Navigator)
15245541 Observational study of gene-disease association. (HuGE Navigator)
15245377 Observational study of genotype prevalence. (HuGE Navigator)
15245373 Observational study of genotype prevalence. (HuGE Navigator)
15243926 identified a strong association between HLA-B*0703 and -DRB1*0301 and the development of severe acute respiratory syndrome
15239092 Observational study of gene-disease association. (HuGE Navigator)
15236755 Observational study of gene-disease association. (HuGE Navigator)
15228651 Observational study of gene-disease association. (HuGE Navigator)
15226359 A single amino acid polymorphism that distinguishes HLA-B*4402 from B*4405 permits B*4405 to constitutively acquire peptides without any detectable incorporation into transporter associated with Ag presentation (TAP)-associated peptide loading complex
15220037 Observational study of gene-disease association. (HuGE Navigator)
15212671 Observational study of gene-disease association. (HuGE Navigator)
15211110 Observational study of gene-disease association. (HuGE Navigator)
15202948 Observational study of gene-disease association. (HuGE Navigator)
15194762 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
15194283 Observational study of genotype prevalence. (HuGE Navigator)
15191952 Observational study of gene-disease association. (HuGE Navigator)
15191523 Observational study of genotype prevalence. (HuGE Navigator)
15167284 Observational study of gene-disease association. (HuGE Navigator)
15158619 Observational study of gene-disease association. (HuGE Navigator)
15158619 A significant increased frequency of HLA-B(*)44, HLA-B(*)52, and HLA-B(*)56 was found in Mexican (Mestizos) patients with Behcet's disease when compared to controls.
15144462 Observational study of gene-disease association. (HuGE Navigator)
15140038 Observational study of genotype prevalence. (HuGE Navigator)
15140031 Observational study of genotype prevalence. (HuGE Navigator)
15140030 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15128924 Observational study of gene-disease association. (HuGE Navigator)
15124939 Observational study of gene-disease association. (HuGE Navigator)
15122136 Observational study of gene-disease association. (HuGE Navigator)
15121303 Observational study of gene-disease association. (HuGE Navigator)
15113995 Observational study of gene-disease association. (HuGE Navigator)
15099766 Observational study of genetic testing. (HuGE Navigator)
15089901 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15089899 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15086350 Observational study of gene-disease association. (HuGE Navigator)
15086345 Observational study of genotype prevalence. (HuGE Navigator)
15078178 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
15072129 Observational study of gene-disease association. (HuGE Navigator)
15070694 selective down-regulation of HLA-A and HLA-Bw6 allospecificities associated with HLA-Bw4 preservation in leukemic cells
15067095 Data indicate that disulfide-linked intracellular heavy chain HLA-B27 complexes are more prone to form and bind molecular chaperone BiP in inflammatory disease-prone wild-type B27 and transgenic B27-C67S rats than in disease-resistant HLA-B7 rats.
15061705 Observational study of gene-disease association. (HuGE Navigator)
15057902 Observational study of gene-disease association. (HuGE Navigator)
15057820 there is a strong association in Han Chinese between a genetic marker, the human leukocyte antigen HLA-B*1502, and Stevens-Johnson syndrome induced by carbamazepine, a drug commonly prescribed for the treatment of seizures
15055259 HLA-B57 significantly associated with susceptibility to psoriasis among population of Northeast region of Romania
15046556 In patients with autoimmune thyroiditis the HLA-B27 frequency of was higher than control values, while in patients with polyglandular activation of autoimmunity or autoimmune polyglandular syndrome type II, the HLA-B8 frequency was found to be higher.
15024131 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15016610 Observational study of gene-environment interaction. (HuGE Navigator)
15009808 Observational study of gene-disease association. (HuGE Navigator)
15009803 Observational study of genotype prevalence. (HuGE Navigator)
15009432 Observational study of gene-disease association. (HuGE Navigator)
15009175 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15000695 Observational study of gene-disease association. (HuGE Navigator)
14989713 Observational study of gene-disease association. (HuGE Navigator)
14969772 Observational study of gene-disease association. (HuGE Navigator)
14965316 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
14748996 The frequency of haplotypes HLA-B in systemic lupus erythematosus group was significantly higher than that of control.
14727453 Observational study of gene-disease association. (HuGE Navigator)
14727382 Observational study of gene-disease association. (HuGE Navigator)
14725340 Observational study of genotype prevalence. (HuGE Navigator)
14719207 Observational study of gene-disease association. (HuGE Navigator)
14719206 Observational study of gene-disease association. (HuGE Navigator)
14705987 Observational study of genotype prevalence. (HuGE Navigator)
14700599 Observational study of genotype prevalence. (HuGE Navigator)
14700598 Observational study of genotype prevalence. (HuGE Navigator)
14700597 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14700596 Observational study of gene-disease association. (HuGE Navigator)
14686115 Observational study of gene-disease association. (HuGE Navigator)
14676447 Observational study of gene-disease association. (HuGE Navigator)
14674935 Observational study of gene-disease association. (HuGE Navigator)
14673570 Observational study of gene-disease association. (HuGE Navigator)
14656748 Observational study of gene-disease association. (HuGE Navigator)
14648147 Observational study of gene-disease association. (HuGE Navigator)
14626512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14617040 a new HLA-B allele (HLA-B*5808) detected in an Italian white volunteer bone marrow donor.
14617038 Observational study of genotype prevalence. (HuGE Navigator)
14595379 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
14581545 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14567462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14557639 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
14551603 Observational study of genotype prevalence. (HuGE Navigator)
14551603 HLA-B haplotypic variation was observed in population groups with ancestry of Africa South of the Sahara.
14551034 Observational study of gene-disease association. (HuGE Navigator)
14530653 Observational study of gene-disease association. (HuGE Navigator)
14527733 Observational study of gene-disease association. (HuGE Navigator)
14527201 Observational study of genotype prevalence. (HuGE Navigator)
14522093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14510801 Observational study of gene-disease association. (HuGE Navigator)
14504973 Observational study of gene-disease association. (HuGE Navigator)
14501803 HLA-B*3520 and B*1801 subtypes were more commonly observed among HIV individuals in Maharasthra, India compared with controls, which reached statistical significance (P<0.01)
14501786 Observational study of gene-disease association. (HuGE Navigator)
12975536 Observational study of gene-disease association. (HuGE Navigator)
12974801 Observational study of genotype prevalence. (HuGE Navigator)
12969506 Observational study of gene-disease association. (HuGE Navigator)
12969506 Results appeared to indicate association of HLA-B* 4601 with the severity of SARS infection in Asian populations.
12964117 Observational study of gene-disease association. (HuGE Navigator)
12964117 white B22 serogroup alleles (B*55 and *56) appear to predispose to unfavorable outcome of HIV infection as strongly as some or all B*35 and B*53 alleles
12963865 Observational study of gene-disease association. (HuGE Navigator)
12956878 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12956877 Observational study of genotype prevalence. (HuGE Navigator)
12941076 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12918696 frequency of HLA-B51 in Iranian patients with Behcet's disease
12917841 Observational study of gene-disease association. (HuGE Navigator)
12911283 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12889998 Observational study of gene-disease association. (HuGE Navigator)
12884192 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12878361 Observational study of gene-disease association. (HuGE Navigator)
12878355 Observational study of gene-disease association. (HuGE Navigator)
12873589 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12859597 A Gambian TNF haplotype matches the European HLA-A1, B8, DR3 and Chinese HLA-A33, B58, DR3 haplotypes.
12859596 Two new HLA-B alleles are reported in a caucasoid male.
12859593 A computational method was used to predict the serologic specificity of HLA molecules encoded by HLA-B.
12850493 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12836198 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12826378 Observational study of gene-disease association. (HuGE Navigator)
12826378 results show that HLA*B2705 and HLA*B2702 are the subtypes most frequently associated with ankylosing spondylitis in a Mestizo population from Venezuela and suggest a possible protector role for HLA*B2708, which was found only in the healthy population
12825172 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12811505 Observational study of gene-disease association. (HuGE Navigator)
12803653 Observational study of gene-disease association. (HuGE Navigator)
12774051 Observational study of gene-disease association. (HuGE Navigator)
12753667 Observational study of genotype prevalence. (HuGE Navigator)
12753657 Observational study of genotype prevalence. (HuGE Navigator)
12746911 Observational study of gene-disease association. (HuGE Navigator)
12746911 In Sardinia, 2 distinct haplotypes harbor the non-AS-associated HLA-B*2709 allele or the AS-associated B27 alleles.
12734905 Observational study of gene-disease association. (HuGE Navigator)
12734410 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12716485 Observational study of gene-environment interaction. (HuGE Navigator)
12714268 Observational study of gene-disease association. (HuGE Navigator)
12694583 Observational study of gene-disease association. (HuGE Navigator)
12694583 HLA-A, -B, and -DRB1 alleles in a total of 236 Taiwanese adults with Graves' disease and 533 racially matched normal control subjects were examined
12691707 Observational study of genotype prevalence. (HuGE Navigator)
12691704 Observational study of gene-disease association. (HuGE Navigator)
12665835 Observational study of gene-disease association. (HuGE Navigator)
12651075 Observational study of gene-disease association. (HuGE Navigator)
12651070 Observational study of gene-disease association. (HuGE Navigator)
12648285 Observational study of genotype prevalence. (HuGE Navigator)
12632436 Observational study of gene-disease association. (HuGE Navigator)
12622781 HLA-B phenotype modifies the course of Behcet's disease in Moroccan patients
12622774 Cloning and sequencing of full-length HLA-B genes
12618907 Observational study of genotype prevalence. (HuGE Navigator)
12618907 analyzed the HLA-B gene frequencies in 281 healthy individuals from four Mexican Amerindian populations (66 Mayos, 90 Mazatecans, 72 Nahuas and 53 Teenek)
12595908 Observational study of gene-disease association. (HuGE Navigator)
12590984 Observational study of genotype prevalence. (HuGE Navigator)
12578601 Observational study of genetic testing. (HuGE Navigator)
12574360 Observational study of gene-disease association. (HuGE Navigator)
12558815 The cDNA matched partial genomic sequences of B*3924, an allele whose distribution appears to be restricted to Mediterranean and Arabian Caucasoids. A single amino acid change exclusive to B*3924 (threonine-98) distinguishes it from B*3903.
12542740 Observational study of genotype prevalence. (HuGE Navigator)
12526811 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12516093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12507825 Observational study of genotype prevalence. (HuGE Navigator)
12507823 Observational study of gene-disease association. (HuGE Navigator)
12507820 Observational study of gene-disease association. (HuGE Navigator)
12502873 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12492815 Observational study of gene-disease association. (HuGE Navigator)
12486606 Observational study of gene-disease association. (HuGE Navigator)
12482663 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12476735 Observational study of gene-disease association. (HuGE Navigator)
12472660 HLA-B allele associations with secondary dengue virus infections correlate with disease severity and the infecting viral serotype in ethnic Thais.
12472659 Conserved TCR beta chain usage in reactive arthritis; evidence for selection by a putative HLA-B27-associated autoantigen.
12464650 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12445319 Observational study of genotype prevalence. (HuGE Navigator)
12445315 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12438586 Observational study of gene-disease association. (HuGE Navigator)
12437654 Observational study of gene-disease association. (HuGE Navigator)
12428239 Observational study of gene-disease association. (HuGE Navigator)
12427289 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12414957 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12392856 Observational study of gene-disease association. (HuGE Navigator)
12392514 New HLA-B alleles identified and sequences extended in potential bone marrow donors: B*5804, B*4418, B*1558, and B*4805
12373032 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12372094 Observational study of gene-disease association. (HuGE Navigator)
12370503 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12370403 Observational study of gene-disease association. (HuGE Navigator)
12370371 A uniquely conformed peptide-containing beta 2m-free HLA-B2705 heavy chain has been isolated, a discovery that opens new avenues for further investigation of the role of HLA-B27 in spondyloarthropathies.
12370085 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12366780 HLA-B*27 is known to be associated with ankylosing spondylitis and several methods have been applied to determine its presence or absence.
12358855 Observational study of genotype prevalence. (HuGE Navigator)
12352262 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12351949 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12296785 Observational study of gene-disease association. (HuGE Navigator)
12244049 subtle peptide conformational alterations may be responsible for the immunobiological differences between the HLA-B27 subtypes
12235090 Observational study of gene-disease association. (HuGE Navigator)
12220628 isolation of a common peptide ligand bound to three HLA B44 alleles; preliminary crystallographic analysis of recombinant forms of each complex
12209364 Observational study of gene-disease association. (HuGE Navigator)
12198621 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12168074 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12144620 Observational study of genotype prevalence. (HuGE Navigator)
12134147 Epistatic interaction between KIR3DS1 and HLA-B delays the progression to AIDS
12117677 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12100686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12100571 Observational study of gene-disease association. (HuGE Navigator)
12097566 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
12074714 Observational study of gene-disease association. (HuGE Navigator)
12074714 Distribution of HLA-B alleles in nasopharyngeal carcinoma patients and normal controls in Thailand.
12068141 Observational study of gene-disease association. (HuGE Navigator)
12047355 Observational study of genotype prevalence. (HuGE Navigator)
12029127 Polymorphisms in HIV-1 reverse transcriptase were most evident at sites of least functional or structural constraint and frequently were associated with particular host HLA-A and HLA-B alleles
12028546 Novel HLA-B alleles formed by an inter-locus recombination with HLA-C, HLA-B*0713 and B*6702.
12028545 Description of six new HLA-B alleles in the 5C CREG including a B*58 intron two sequence
12028538 Observational study of gene-disease association. (HuGE Navigator)
12028538 Sequencing-based typing of HLA-B*51 alleles and the significant association of HLA-B*5101 and -B*5108 with Behcet's disease in Greek patients.
12010826 Observational study of gene-disease association. (HuGE Navigator)
11984513 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11979305 Observational study of gene-disease association. (HuGE Navigator)
11972884 Identification of a new HLA-B*07 allele--HLA-B*0726.
11972879 identification of new allele, B*3805
11953462 T8 cells with HLA-B*5701 or 5703 show cross-reactive tetramer binding with common and rare variants of an HIV-1 p24 epitope.
11932387 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11927505 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11904677 Observational study of genotype prevalence. (HuGE Navigator)
11903375 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
11888582 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11862403 MICA genetic polymorphism and linkage disequilibrium with HLA-B in 29 African-American families
11862383 Disparate binding of chaperone proteins by HLA-A subtypes
11861287 Soluble HLA class I molecules induce natural killer cell apoptosis through the engagement of CD8. HLA-A2, -Cw4, and -Bw46 alleles, or HLA-G1 leads to NK cell apoptosis.
11841486 association of TNF alleles with HLA-DR, -DQ and -B alleles in 216 healthy individuals from the north of England
11841366 Observational study of gene-disease association. (HuGE Navigator)
11840200 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11839711 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11831114 Observational study of gene-disease association. (HuGE Navigator)
11752149 magnitude and specificity of influenza A virus-specific cytotoxic T-lymphocyte responses in humans is related to HLA-A and -B phenotype
11751963 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11737038 Observational study of gene-disease association. (HuGE Navigator)
11703826 Observational study of gene-disease association. (HuGE Navigator)
11687612 Observational study of gene-disease association. (HuGE Navigator)
11602047 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11578695 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11543903 Observational study of genotype prevalence. (HuGE Navigator)
11543893 Observational study of genotype prevalence. (HuGE Navigator)
11543892 Observational study of genotype prevalence. (HuGE Navigator)
11508592 Observational study of gene-disease association. (HuGE Navigator)
11507979 Observational study of gene-disease association. (HuGE Navigator)
11507213 Observational study of gene-disease association. (HuGE Navigator)
11500821 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11485622 Observational study of gene-disease association. (HuGE Navigator)
11480844 Observational study of gene-disease association. (HuGE Navigator)
11474249 Observational study of gene-disease association. (HuGE Navigator)
11464148 Observational study of gene-disease association. (HuGE Navigator)
11463741 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11438519 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11426025 Observational study of gene-disease association. (HuGE Navigator)
11423176 Observational study of gene-disease association. (HuGE Navigator)
11409121 Observational study of gene-disease association. (HuGE Navigator)
11396948 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11390038 Observational study of gene-disease association. (HuGE Navigator)
11386265 Observational study of gene-disease association. (HuGE Navigator)
11380943 Observational study of genotype prevalence. (HuGE Navigator)
11374682 Observational study of gene-disease association. (HuGE Navigator)
11294566 Observational study of gene-disease association. (HuGE Navigator)
11291046 Observational study of gene-disease association. (HuGE Navigator)
11289809 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
11285128 Observational study of genotype prevalence. (HuGE Navigator)
11285127 Observational study of genotype prevalence. (HuGE Navigator)
11266078 Observational study of gene-environment interaction. (HuGE Navigator)
11260515 Observational study of genotype prevalence. (HuGE Navigator)
11260507 Observational study of genotype prevalence. (HuGE Navigator)
11260506 Observational study of genotype prevalence. (HuGE Navigator)
11229461 Observational study of gene-disease association. (HuGE Navigator)
11208333 Observational study of gene-disease association. (HuGE Navigator)
11182229 Observational study of gene-disease association. (HuGE Navigator)
11182228 Observational study of genotype prevalence. (HuGE Navigator)
11181188 Observational study of gene-disease association. (HuGE Navigator)
11180452 Observational study of gene-disease association. (HuGE Navigator)
11169245 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11169242 Observational study of genotype prevalence. (HuGE Navigator)
11169240 Observational study of genotype prevalence. (HuGE Navigator)
11144289 Observational study of genotype prevalence. (HuGE Navigator)
11120862 Observational study of gene-disease association. (HuGE Navigator)
11119299 Observational study of genotype prevalence. (HuGE Navigator)
11118029 Observational study of gene-disease association. (HuGE Navigator)
11098929 Observational study of genotype prevalence. (HuGE Navigator)
11096258 Observational study of gene-disease association. (HuGE Navigator)
11064107 Observational study of gene-disease association. (HuGE Navigator)
11053636 Observational study of gene-environment interaction. (HuGE Navigator)
11045789 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11024213 Observational study of genotype prevalence. (HuGE Navigator)
11010837 Observational study of gene-disease association. (HuGE Navigator)
10982373 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
10954160 Observational study of genotype prevalence. (HuGE Navigator)
10799863 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
10707087 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
10684310 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
10546855 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
10403641 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
10366557 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9971776 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9840288 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9751712 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9586638 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9582271 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9373217 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9263011 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9123874 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9120272 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9104816 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
9052838 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
8877415 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
8671651 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
8612235 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
8493575 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
8084338 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
7913356 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
7621073 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
7539755 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
2789433 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively
1316930 Two ASP peptide sequences, ASP-YL9 (89YLYNSLLQL97) and ASP-TL10 (79TPNGSIFTTL88), show high binding affinity to HLA-A*02 and HLA-B*07 molecules, respectively

AA Sequence

MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE      1 - 70
PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQF     71 - 140
AYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPK    141 - 210
THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAASS    281 - 350
DSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (1700)

PMID Year Title
26967484 2016 The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population.
26841353 2016 Activation-Induced Killer Cell Immunoglobulin-like Receptor 3DL2 Binding to HLA-B27 Licenses Pathogenic T Cell Differentiation in Spondyloarthritis.
26819491 2015 Significant Association of HLA-B Alleles and Genotypes in Thai Children with Autism Spectrum Disorders: A Case-Control Study.
26787826 2016 Relative Resistance of HLA-B to Downregulation by Naturally Occurring HIV-1 Nef Sequences.
26758079 2016 Understanding the obstacle of incompatibility at residue 156 within HLA-B*35 subtypes.
26669670 2015 The HLA-B*35 allele modulates ER stress, inflammation and proliferation in PBMCs from Limited Cutaneous Systemic Sclerosis patients.
26640809 2015 Analysis of a Functional IL-6 Gene Polymorphism in HLAB27 Associated and Intermediate Uveitis Gives New Insight in Disease Pathogenesis and Commonality with Other Autoimmune Diseases.
26613595 2015 An HLA-C amino-acid variant in addition to HLA-B*27 confers risk for ankylosing spondylitis in the Korean population.
26610302 The genetic associations of acute anterior uveitis and their overlap with the genetics of ankylosing spondylitis.
26599303 2016 HLA-B*38:02:01 predicts carbimazole/methimazole-induced agranulocytosis.
26560062 2015 Analysis of HLA-B15 and HLA-B27 in spondyloarthritis with peripheral and axial clinical patterns.
26555631 2015 Do HLA-A markers predict skin-reactions from aromatic antiepileptic drugs in a Norwegian population? A case control study.
26494593 2016 Presence of HLA-B27 is associated with changes of serum levels of mediators of the Wnt and hedgehog pathway.
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26469786 2015 Interaction between HLA-B60 and HLA-B27 as a Better Predictor of Ankylosing Spondylitis in a Taiwanese Population.
26416272 2015 Mechanistic Basis for Epitope Proofreading in the Peptide-Loading Complex.
26395086 2015 Sponyloarthritis features forecasting the presence of HLA-B27 or sacroiliitis on magnetic resonance imaging in patients with suspected axial spondyloarthritis: results from a cross-sectional study in the ESPeranza Cohort.
26375851 2015 Comprehensive Analysis of the Naturally Processed Peptide Repertoire: Differences between HLA-A and B in the Immunopeptidome.
26355081 2015 Consequences of HLA-B*13-Associated Escape Mutations on HIV-1 Replication and Nef Function.
26331842 2015 Molecular Dynamics Simulation Reveals the Selective Binding of Human Leukocyte Antigen Alleles Associated with Behçet's Disease.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking.
26314893 HLA-B27 subtypes in enthesitis-related arthritis category of juvenile idiopathic arthritis and ankylosing spondylitis in northern India.
26282450 2015 The HLA-A*2402/Cw*0102 haplotype is associated with lamotrigine-induced maculopapular eruption in the Korean population.
26273634 2015 Clinical Features in Juvenile-Onset Ankylosing Spondylitis Patients Carrying Different B27 Subtypes.
26258424 2015 Cell surface expression level variation between two common Human Leukocyte Antigen alleles, HLA-A2 and HLA-B8, is dependent on the structure of the C terminal part of the alpha 2 and the alpha 3 domains.
26248534 2015 Prevalence of HLA-B27 in Moroccan healthy subjects and patients with ankylosing spondylitis and mapping construction of several factors influencing AS diagnosis by using multiple correspondence analysis.
26199258 2015 Relationships of Human Leukocyte Antigen-A, -B, -DRB1 Alleles, and Haplotypes in 129 Ethnic Turkish Patients With Acute Myeloblastic Leukemia.
26169100 2015 Developmental expression and localization of MHC class I molecules in the human central nervous system.
26133380 2015 Associations of Independent IL2RA Gene Variants with Intermediate Uveitis.
26125763 2015 Human leukocyte antigen-B27 alleles in Xinjiang Uygur patients with ankylosing spondylitis.
26083016 2015 Accuracy of SNPs to predict risk of HLA alleles associated with drug-induced hypersensitivity events across racial groups.
26070312 2015 Genetic determinants of cocaine-associated agranulocytosis.
26068923 2015 Protective Effect of HLA-B*5701 and HLA-C -35 Genetic Variants in HIV-Positive Caucasians from Northern Poland.
26057149 2015 Epstein-Barr virus latent membrane protein 2A mediated activation of Sonic Hedgehog pathway induces HLA class Ia downregulation in gastric cancer cells.
26036218 2015 Genotypes at rs2844682 and rs3909184 have no clinical value in identifying HLA-B*15:02 carriers.
25994336 2015 Major histocompatibility complex associations of ankylosing spondylitis are complex and involve further epistasis with ERAP1.
25976429 2015 HLA-B*38:55Q: a new alternatively expressed allele identified in a three-generation Italian family.
25972545 2015 Respiratory Syncytial Virus Infection Upregulates NLRC5 and Major Histocompatibility Complex Class I Expression through RIG-I Induction in Airway Epithelial Cells.
25962691 Effects of tumor necrosis factor-? inhibitors in mothers and daughters concordant for HLA-B27-positive ankylosing spondylitis.
25956157 2016 Private rare deletions in SEC16A and MAMDC4 may represent novel pathogenic variants in familial axial spondyloarthritis.
25953150 2015 The HLA-B*4601-DRB1*0901 haplotype is positively correlated with juvenile ocular myasthenia gravis in a southern Chinese Han population.
25948071 2015 Concepts of pathogenesis in psoriatic arthritis: genotype determines clinical phenotype.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940109 2015 On the genetics of the Silk Route: association analysis of HLA, IL10, and IL23R-IL12RB2 regions with Behçet's disease in an Iranian population.
25934581 2015 Pharmacogenetics of abacavir hypersensitivity: A systematic review and meta-analysis of the association with HLA-B*57:01.
25931203 2015 Takayasu arteritis and ulcerative colitis: high rate of co-occurrence and genetic overlap.
25922880 2015 Prevalence of HLA-B*57:01 allele in Argentinean HIV-1 infected patients.
25918017 2016 HLA-B*59:01: a marker for Stevens-Johnson syndrome/toxic epidermal necrolysis caused by methazolamide in Han Chinese.
25894610 2015 The Rate of Helicobacter pylori Seropositivity in a Group of Korean Patients with HLA-B27-Associated Acute Anterior Uveitis.
25889603 2015 Association of HLA-B*41:02 with Henoch-Schönlein Purpura (IgA Vasculitis) in Spanish individuals irrespective of the HLA-DRB1 status.
25889189 2015 Characterization of the major histocompatibility complex locus association with Behçet's disease in Iran.
25877443 2015 Association of HLA-B*5701 genotypes and abacavir-induced hypersensitivity reaction: a systematic review and meta-analysis.
25872744 2015 Viral evolution in HLA-B27-restricted CTL epitopes in human immunodeficiency virus type 1-infected individuals.
25754738 2015 Relative expression levels of the HLA class-I proteins in normal and HIV-infected cells.
25752521 2015 Tag SNPs for HLA-B alleles that are associated with drug response and disease risk in the Chinese Han population.
25746818 2015 Rapid human immunodeficiency virus disease progression is associated with human leukocyte antigen-B homozygocity and human leukocyte antigen-B51 in a cohort from Manitoba, Canada.
25700963 2015 HLA associations and HLA sharing in recurrent miscarriage: A systematic review and meta-analysis.
25684766 2015 Mortality in American Veterans with the HLA-B27 gene.
25677350 2015 HLA-B alleles B*15:01 and B*15:02: opposite association with hepatitis C virus infection in Chinese voluntary blood donors.
25666956 2015 DNA typing of HLA-A, -C, -B, AND -DRB1 in the children with autism in the Republic of Macedonia.
25647819 2014 Association between HLA-B*15:02 allele and antiepileptic drug-induced severe cutaneous reactions in Hong Kong Chinese: a population-based study.
25636577 2015 Comparison of the KIR3DS1/Bw4 distribution in Chinese healthy and acute myeloid leukemia individuals.
25634791 2015 Recurrent HLA-B56 mediated neonatal alloimmune thrombocytopenia with fatal outcomes.
25626601 2015 Polymorphisms of HLA-A, -B, -Cw and DRB1 antigens in Moroccan patients with ankylosing spondylitis and a comparison of clinical features with frequencies of HLA-B*27.
25606786 2015 Three-dimensional structural modelling and calculation of electrostatic potentials of HLA Bw4 and Bw6 epitopes to explain the molecular basis for alloantibody binding: toward predicting HLA antigenicity and immunogenicity.
25582852 2015 The D0 Ig-like domain plays a central role in the stronger binding of KIR3DL2 to B27 free H chain dimers.
25566896 Drug eruptions induced by allopurinol associated with HLA-B*5801.
25549594 2014 HLA-A*26 and susceptility of iranian patients with non-Hodgkin lymphoma.
25545232 2015 Donors with HLA-B*58:01/TNF? ? 308A haplotype are unfavorable to haploidentical hematopoietic stem cell transplantation in acute lymphoblastic leukemia.
25521205 2014 Refinement of the MHC risk map in a scandinavian primary sclerosing cholangitis population.
25495410 2014 HLA-A*02:01:01/-B*35:01:01/-C*04:01:01 haplotype associated with lamotrigine-induced maculopapular exanthema in Mexican Mestizo patients.
25480565 2015 The interaction of KIR3DL1*001 with HLA class I molecules is dependent upon molecular microarchitecture within the Bw4 epitope.
25428396 2015 Association of HLA-B*1502 allele with lamotrigine-induced Stevens-Johnson syndrome and toxic epidermal necrolysis in Han Chinese subjects: a meta-analysis.
25413106 2014 Nonfrequent but well-documented, rare and very rare HLA alleles observed in the Croatian population.
25355886 2015 Varicella-zoster virus-derived major histocompatibility complex class I-restricted peptide affinity is a determining factor in the HLA risk profile for the development of postherpetic neuralgia.
25330014 2014 Time to seroconversion in HIV-exposed subjects carrying protective versus non protective KIR3DS1/L1 and HLA-B genotypes.
25327504 2015 Clinical features of and genetic predisposition to drug-induced Stevens-Johnson syndrome and toxic epidermal necrolysis in a single Korean tertiary institution patients-investigating the relation between the HLA -B*4403 allele and lamotrigine.
25305458 2014 HLA-B? 1502 is associated with carbamazepine induced Stevens-Johnson syndrome in North Indian population.
25297839 Genetic variation in the HLA region is associated with susceptibility to herpes zoster.
25295286 2014 Comparisons of CVID and IgGSD: referring physicians, autoimmune conditions, pneumovax reactivity, immunoglobulin levels, blood lymphocyte subsets, and HLA-A and -B typing in 432 adult index patients.
25286002 2014 The frequency of HLA-B(?)57:01 and the risk of abacavir hypersensitivity reactions in the majority population of Costa Rica.
25266342 2014 HLA-B*15:02 association with carbamazepine-induced Stevens-Johnson syndrome and toxic epidermal necrolysis in an Indian population: a pooled-data analysis and meta-analysis.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
25261574 2016 Certain class I HLA alleles and haplotypes implicated in susceptibility play a role in determining specific features of the psoriatic arthritis phenotype.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25243920 2014 Human herpesvirus 6B immediate-early I protein contains functional HLA-A*02, HLA-A*03, and HLA-B*07 class I restricted CD8(+) T-cell epitopes.
25234663 2015 Characteristics associated with the presence and development of extra-articular manifestations in ankylosing spondylitis: 12-year results from OASIS.
25226169 2014 Disentangling human tolerance and resistance against HIV.
25209151 2014 Resolution of HLA-B*44:02:01G, -DRB1*14:01:01G and -DQB1*03:01:01G reveals a high allelic variability among 12 European populations.
25187890 2014 Absence of HLA-B*1502 and HLA-A*3101 alleles in 9 Korean patients with antiepileptic drug-induced skin rash: a preliminary study.
25187574 2014 Peptide handling by HLA-B27 subtypes influences their biological behavior, association with ankylosing spondylitis and susceptibility to endoplasmic reticulum aminopeptidase 1 (ERAP1).
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25154780 2014 Identification and characterisation of peptide binding motifs of six autoimmune disease-associated human leukocyte antigen-class I molecules including HLA-B*39:06.
25146482 2015 Coupling between side chain interactions and binding pocket flexibility in HLA-B*44:02 molecules investigated by molecular dynamics simulations.
25139336 2014 KIR diversity in M?ori and Polynesians: populations in which HLA-B is not a significant KIR ligand.
25128507 2014 Is HLA-B27 increased in patients diagnosed with undifferentiated arthritis? Results from the Leiden early arthritis cohort.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
25099678 2014 Trans-ethnic study confirmed independent associations of HLA-A*02:06 and HLA-B*44:03 with cold medicine-related Stevens-Johnson syndrome with severe ocular surface complications.
25099164 2014 Clinical pharmacogenetics implementation consortium guidelines for CYP2C9 and HLA-B genotypes and phenytoin dosing.
25062414 2014 HLA-B51 subtypes in Turkish patients with Behçet's disease and their correlation with clinical manifestations.
25008926 2014 Impact of HLA selection pressure on HIV fitness at a population level in Mexico and Barbados.
24979673 2014 The polymorphisms of human leukocyte antigen loci may contribute to the susceptibility and severity of severe aplastic anemia in Chinese patients.
24963477 2014 The association of HLA-class I and class II with Hodgkin's lymphoma in Iranian patients.
24956250 2014 Diagnostic accuracy of HLA-B*57:01 screening for the prediction of abacavir hypersensitivity and clinical utility of the test: a meta-analytic review.
24929144 2014 KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C.
24917365 2014 Associations between polymorphisms of HLA-B gene and postmenopausal osteoporosis in Chinese Han population.
24887019 2014 Behçet's disease in HLA-B*51 negative Germans and Turks shows association with HLA-Bw4-80I.
24871931 2015 HLA-B*1502 increases the risk of phenytoin or lamotrigine induced Stevens-Johnson Syndrome/toxic epidermal necrolysis: evidence from a meta-analysis of nine case-control studies.
24853499 2014 Impact of HLA-B*35 subtype differences on HIV disease outcome in Mexico.
24835397 2014 HLA-B27, but not HLA-B7, immunodominance to influenza is ERAP dependent.
24829406 2014 N?-terminal acetylation for T cell recognition: molecular basis of MHC class I-restricted n?-acetylpeptide presentation.
24790147 2014 Distinct assembly profiles of HLA-B molecules.
24782188 2014 Long-term outcome of neuro-Behçet's disease.
24781922 2014 Independent strong association of HLA-A*02:06 and HLA-B*44:03 with cold medicine-related Stevens-Johnson syndrome with severe mucosal involvement.
24771481 2014 Altered bone material properties in HLA-B27 rats include reduced mineral to matrix ratio and altered collagen cross-links.
24762294 2014 External quality assessment of patient HLA-B*57:01 testing prior to abacavir prescription.
24755352 2014 Killer cell immunoglobulin-like receptors in Thai patients with leukemia and diffuse large B-cell lymphoma.
24740510 2014 Functional avidity and IL-2/perforin production is linked to the emergence of mutations within HLA-B*5701-restricted epitopes and HIV-1 disease progression.
24737799 2014 HLA and killer cell immunoglobulin-like receptors influence the natural course of CMV infection.
24731753 2014 T cells infiltrate the liver and kill hepatocytes in HLA-B(?)57:01-associated floxacillin-induced liver injury.
24718028 2014 Association of the HLA-B*52 allele with non-progression to AIDS in Brazilian HIV-1-infected individuals.
24717292 2014 Impact of donor mismatches at individual HLA-A, -B, -C, -DR, and -DQ loci on the development of HLA-specific antibodies in patients listed for repeat renal transplantation.
24716975 2014 Identification of a novel fusion gene (HLA-E and HLA-B) by RNA-seq analysis in esophageal squamous cell carcinoma.
24691290 2014 An analysis of HLA-A, -B, and -DRB1 allele and haplotype frequencies of 21,918 residents living in Liaoning, China.
24666027 2014 Association of HLA-B27 and ERAP1 with ankylosing spondylitis susceptibility in Beijing Han Chinese.
24661088 2014 Phenotypic abnormalities of peripheral blood mononuclear cells in patients with Behçet's disease and association with HLA-B51 expression.
24600035 2014 Molecular basis of a dominant T cell response to an HIV reverse transcriptase 8-mer epitope presented by the protective allele HLA-B*51:01.
24597466 2014 Recommendations for HLA-B*15:02 and HLA-A*31:01 genetic testing to reduce the risk of carbamazepine-induced hypersensitivity reactions.
24591375 2014 Oxypurinol directly and immediately activates the drug-specific T cells via the preferential use of HLA-B*58:01.
24566094 2014 HLA-B*35: 05 is a protective allele with a unique structure among HIV-1 CRF01_AE-infected Thais, in whom the B*57 frequency is low.
24563253 2014 Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity.
24554773 2014 NK cell killer Ig-like receptor repertoire acquisition and maturation are strongly modulated by HLA class I molecules.
24534717 The classification and diagnostic criteria of ankylosing spondylitis.
24533711 2014 Detection of HLA-B*57:01 by real-time PCR: implementation into routine clinical practice and additional validation data.
24532677 2015 A genome-wide association study of rheumatoid arthritis without antibodies against citrullinated peptides.
24517468 2014 Small duct primary sclerosing cholangitis without inflammatory bowel disease is genetically different from large duct disease.
24498994 2013 Higher risk of uveitis and dactylitis and older age of onset among ankylosing spondylitis patients with HLA-B*2705 than patients with HLA-B*2704 in the Chinese population.
24498993 2013 HLA alleles and HLA-B27 haplotypes associated with susceptibility and severity of ankylosing spondylitis in a Portuguese population.
24496695 2014 Association of HLA-B*1502 and *1511 allele with antiepileptic drug-induced Stevens-Johnson syndrome in central China.
24453969 2014 HIV protective KIR3DL1/S1-HLA-B genotypes influence NK cell-mediated inhibition of HIV replication in autologous CD4 targets.
24428874 2014 The relationship between plasma homocysteine level and HLA-B51 in patients with Behcet's disease: a case-control study.
24415937 2014 In vivo functions of CPSF6 for HIV-1 as revealed by HIV-1 capsid evolution in HLA-B27-positive subjects.
24399721 2013 Association between the HLA-B*15:02 allele and carbamazepine-induced Stevens-Johnson syndrome/toxic epidermal necrolysis in Han individuals of northeastern China.
24390323 2014 HLA-B*57 elite suppressor and chronic progressor HIV-1 isolates replicate vigorously and cause CD4+ T cell depletion in humanized BLT mice.
24390108 2013 2 cases of HLA-B27-positive seronegative spondylarthritides in pediatric age treated with adalimumab.
24389314 2014 Association analysis between HLA-A, -B, -C, -DRB1, and -DQB1 with nasopharyngeal carcinoma among a Han population in Northwestern China.
24364037 2013 HLA-B*40 allele plays a role in the development of acute leukemia in Mexican population: a case-control study.
24362932 2014 Short peptide sequence identity between human viruses and HLA-B27-binding human 'self' peptides.
24352655 2014 Combined effects of ankylosing spondylitis-associated ERAP1 polymorphisms outside the catalytic and peptide-binding sites on the processing of natural HLA-B27 ligands.
24351517 2015 Prevalence of spondyloarthritis in reference to HLA-B27 in the French population: results of the GAZEL cohort.
24349500 2013 KIR, HLA, and IL28B variant predict response to antiviral therapy in genotype 1 chronic hepatitis C patients in Japan.
24339913 2013 HIV-1 replication fitness of HLA-B*57/58:01 CTL escape variants is restored by the accumulation of compensatory mutations in gag.
24336023 2014 HLA alleles and hypersensitivity to carbamazepine: an updated systematic review with meta-analysis.
24326010 2015 FUT2: filling the gap between genes and environment in Behçet's disease?
24324956 2013 Allicin attenuates inflammation and suppresses HLA-B27 protein expression in ankylosing spondylitis mice.
24324503 2013 Association of human leukocyte antigen class I polymorphism with spontaneous clearance of hepatitis B surface antigen in Qidong Han population.
24308748 2014 Association of HLA-B*51:01 with papillary thyroid carcinoma in the Chinese Han population of the Shandong coastal areas.
24286455 2013 Prevalence of HLA-B27 in the New Zealand population: effect of age and ethnicity.
24286189 2013 HLA and non-HLA genes in Behçet's disease: a multicentric study in the Spanish population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24261772 2014 Association of HLA-B27 genetic polymorphisms with ankylosing spondylitis susceptibility worldwide: a meta-analysis.
24257027 2014 HLA-B60 and the HLA-B27/HLA-B60 genotype are not risk factors for acute anterior uveitis.
24245727 2013 Temporal effect of HLA-B*57 on viral control during primary HIV-1 infection.
24223975 2013 Concerted in vitro trimming of viral HLA-B27-restricted ligands by human ERAP1 and ERAP2 aminopeptidases.
24157097 2013 Association analysis of the major histocompatibility complex, class II, DQ ?1 gene, HLA-DQB1, with narcolepsy in Han Chinese patients from Taiwan.
24152261 2013 HLA-B*13:01 and the dapsone hypersensitivity syndrome.
24151602 2013 Role of Rheum Polysaccharide in the cytokines produced by peripheral blood monocytes in TLR4 mediated HLA-B27 associated AAU.
24131020 2013 Epidemiological comparison of clinical manifestations according to HLA-B*27 carrier status of Chinese ankylosing spondylitis patients.
24113999 2013 Co-expression of HLA-B7 and HLA-B27 alleles is associated with B7-restricted immunodominant responses following influenza infection.
24084328 2013 HLA-A2, HLA-B44 and HLA-DR15 are associated with lower risk of BK viremia.
24059286 2013 KIR3DS1/L1 and HLA-Bw4-80I are associated with HIV disease progression among HIV typical progressors and long-term nonprogressors.
24055898 2014 The HLA-B*39 allele increases type 1 diabetes risk conferred by HLA-DRB1*04:04-DQB1*03:02 and HLA-DRB1*08-DQB1*04 class II haplotypes.
24046013 2013 High-resolution HLA matching in hematopoietic stem cell transplantation: a retrospective collaborative analysis.
24033735 2013 The role of the human leukocyte antigen system in retinopathy of prematurity: a pilot study.
24029662 Human leukocyte antigen B distribution in HIV discordant cohort from India.
24028501 2013 Endoplasmic reticulum aminopeptidase-1 alleles associated with increased risk of ankylosing spondylitis reduce HLA-B27 mediated presentation of multiple antigens.
23994122 2014 Distribution of HLA-A, B and DRB1 alleles in Sahariya tribe of North Central India: an association with pulmonary tuberculosis.
23993278 2014 HLA-B27 misfolding and ankylosing spondylitis.
23992015 2013 HLA-A, HLA-B, HLA-DRB1 polymorphisms and risk of cervical squamous epithelial cell carcinoma: a population study in China.
23984333 2013 Immunoinformatic docking approach for the analysis of KIR3DL1/HLA-B interaction.
23956249 2015 Evolution of radiographic damage in ankylosing spondylitis: a 12 year prospective follow-up of the OASIS study.
23953521 HLA-A, -B, -DRB1 allele and haplotype frequencies and comparison with blood group antigens in dialysis patients in the East Anatolia region of Turkey.
23937715 2013 Cardiac conduction system abnormalities in ankylosing spondylitis: a cross-sectional study.
23935489 2013 Association study of common genetic variants and HIV-1 acquisition in 6,300 infected cases and 7,200 controls.
23916069 2014 HLA-B27 and antigen presentation: at the crossroads between immune defense and autoimmunity.
23910730 2014 The biochemistry and immunology of non-canonical forms of HLA-B27.
23899968 An analysis of 372 patients with anterior uveitis in a large Ibero-American cohort of spondyloarthritis: the RESPONDIA Group.
23894643 2013 Altered regulation of ELAVL1/HuR in HLA-B27-expressing U937 monocytic cells.
23884208 2013 Relationship between the HLA-B*1502 allele and carbamazepine-induced Stevens-Johnson syndrome and toxic epidermal necrolysis: a systematic review and meta-analysis.
23873822 2013 Association of Takayasu arteritis with HLA-B 67:01 and two amino acids in HLA-B protein.
23835632 2013 Association between HLA alleles and HAM/TSP in individuals infected with HTLV-1.
23830516 2013 Two susceptibility loci to Takayasu arteritis reveal a synergistic role of the IL12B and HLA-B regions in a Japanese population.
23829937 2013 The association between oxcarbazepine-induced maculopapular eruption and HLA-B alleles in a northern Han Chinese population.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23804219 2013 The arthritis-associated HLA-B*27:05 allele forms more cell surface B27 dimer and free heavy chain ligands for KIR3DL2 than HLA-B*27:09.
23800305 2013 Functional variants of ERAP1 gene are associated with HLA-B27 positive spondyloarthritis.
23740229 2014 Evidence that autophagy, but not the unfolded protein response, regulates the expression of IL-23 in the gut of patients with ankylosing spondylitis and subclinical gut inflammation.
23729098 A comparative study of the genetics of Behcet's disease in Iraq: international collaboration to transfer clinical and laboratory skills to Baghdad medical school and hospitals.
23724919 2013 HLA-A, -B and -DRB1 polymorphism in Koreans defined by sequence-based typing of 4128 cord blood units.
23692434 2013 HLA-B alleles associated with severe cutaneous reactions to antiepileptic drugs in Han Chinese.
23677320 2013 HLA-B*44 is associated with a lower viral set point and slow CD4 decline in a cohort of Chinese homosexual men acutely infected with HIV-1.
23669020 2013 HLA-B*58:01 strongly associates with allopurinol-induced adverse drug reactions in a Japanese sample population.
23646949 2013 Peptide-binding motifs and characteristics for HLA -B*13:01 molecule.
23638805 2013 Association between HLA genes and American cutaneous leishmaniasis in endemic regions of Southern Brazil.
23636221 Relation of HLA class I and II supertypes with spontaneous clearance of hepatitis C virus.
23614044 2013 Association between polymorphism of the vitamin D metabolism gene CYP27B1 and HLA-B27-associated uveitis. Is a state of relative immunodeficiency pathogenic in HLA B27-positive uveitis?
23604100 2013 Association between HLA-B*1301 and dapsone-induced hypersensitivity reactions among leprosy patients in China.
23600531 2013 HLA-B*58:01 is a risk factor for allopurinol-induced DRESS and Stevens-Johnson syndrome/toxic epidermal necrolysis in a Portuguese population.
23600465 2013 Meta-analysis of the association between psoriasis and human leucocyte antigen-B.
23590408 2013 Identification of a novel HLA-B*27 allele, B*27:79 and the B*27 subtype polymorphism in the Hunan ethnic Han population of China.
23588310 2013 HLA-A 31:01 and HLA-B 15:02 as genetic markers for carbamazepine hypersensitivity in children.
23569211 2013 Highly divergent T-cell receptor binding modes underlie specific recognition of a bulged viral peptide bound to a human leukocyte antigen class I molecule.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23536655 2013 Epstein-Barr virus negativity among individuals older than 60 years is associated with HLA-C and HLA-Bw4 variants and tonsillectomy.
23527218 2013 Novel interaction between proliferating cell nuclear antigen and HLA I on the surface of tumor cells inhibits NK cell function through NKp44.
23521884 2013 A molecular basis for the control of preimmune escape variants by HIV-specific CD8+ T cells.
23505543 2013 Ultrasonographic assessment of enthesitis in HLA-B27 positive patients with rheumatoid arthritis, a matched case-only study.
23462218 2013 MHC-driven HIV-1 control on the long run is not systematically determined at early times post-HIV-1 infection.
23430249 2013 Natural HLA-B*2705 protein ligands with glutamine as anchor motif: implications for HLA-B27 association with spondyloarthropathy.
23417110 2013 Genome-wide association study identified the human leukocyte antigen region as a novel locus for plasma beta-2 microglobulin.
23376458 2013 HLA class I and II alleles are associated with microvascular complications of type 1 diabetes.
23376085 2013 21-Hydroxylase gene mutant allele CYP21A2*15 strongly linked to the resistant HLA haplotype B*14:02-DRB1*01:02 in chronic Chagas disease.
23356447 2013 High prevalence of spondyloarthritis and ankylosing spondylitis among familial Mediterranean fever patients and their first-degree relatives: further evidence for the connection.
23349864 2013 Separate developmental programs for HLA-A and -B cell surface expression during differentiation from embryonic stem cells to lymphocytes, adipocytes and osteoblasts.
23349666 2013 Phosphorylation of STAT-1 serine 727 is prolonged in HLA-B27-expressing human monocytic cells.
23330836 2013 Association of human leukocyte antigen class I antigens in Iranian patients with pemphigus vulgaris.
23329888 2013 Association between HLA-B*46 allele and Graves disease in Asian populations: a meta-analysis.
23328091 2013 Associations between HLA-DRB1*0102, HLA-B*5801, and hepatotoxicity during initiation of nevirapine-containing regimens in South Africa.
23326239 2013 A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).
23278608 2013 Human leukocyte antigens class I and class II in patients with pemphigus in southern Turkey.
23272049 2012 Genetic polymorphisms of stromal interaction molecule 1 associated with the erythrocyte sedimentation rate and C-reactive protein in HLA-B27 positive ankylosing spondylitis patients.
23266622 2013 KIR genes and HLA class I ligands in Gaucher disease.
23252655 2013 HLA-B27 and clinical features of acute anterior uveitis in Cuba.
23246585 2013 Filling the gaps - the generation of full genomic sequences for 15 common and well-documented HLA class I alleles using next-generation sequencing technology.
23245688 2013 Down-regulation of human leukocyte antigen class I (HLA-I) is associated with poor prognosis in patients with clear cell renal cell carcinoma.
23232549 2013 Clinical Pharmacogenetics Implementation Consortium guidelines for human leukocyte antigen-B genotype and allopurinol dosing.
23229474 2013 Dynamics of free versus complexed ?2-microglobulin and the evolution of interfaces in MHC class I molecules.
23220495 2013 Differing HLA types influence inhibitory receptor signalling in CMV-specific CD8+ T cells.
23215727 2012 Diversity of HLA-B*35 alleles and haplotypes among Croatians.
23200758 2013 High-resolution HLA haplotype frequencies of stem cell donors in Germany with foreign parentage: how can they be used to improve unrelated donor searches?
23190492 2013 A novel HLA-B allele, B*58:01:12, detected in a Taiwanese volunteer bone marrow stem cell donor using sequence-based typing method.
23177929 2013 Non-random mating, parent-of-origin, and maternal-fetal incompatibility effects in schizophrenia.
23176610 2013 Linkage disequilibrium between TNF-?-308 G/A promoter and histocompatibility leukocyte antigen alleles in Han-nationality lung transplant recipients from Eastern China.
23121897 2013 Two novel alleles at HLA-B locus identified in two volunteer bone marrow donors by sequence-based typing.
23103378 2013 Role of HLA-B ?-3 domain amino acid position 194 in HIV disease progression.
23089920 2012 Susceptibility to toxoplasmic retinochoroiditis is associated with HLA alleles reported to be implicated with rapid progression to AIDS.
23071161 2012 High frequency of HLA B62 in fulminant type 1 diabetes with the drug-induced hypersensitivity syndrome.
23068784 2013 Immunodominance of HLA-B27-restricted HIV KK10-specific CD8(+) T-cells is not related to naïve precursor frequency.
23055271 2012 Risk for myasthenia gravis maps to a (151) Pro?Ala change in TNIP1 and to human leukocyte antigen-B*08.
23025739 2012 Severe drug-induced hypersensitivity syndrome with a shared HLA-B allele.
23021043 Genetics of Behçet's disease in Sardinia: two distinct extended HLA haplotypes harbour the B*51 allele in the normal population and in patients.
23020308 2012 The HLA-B gene and Hashimoto disease in Han Chinese children: a case-control and family-based study.
23015131 2012 Peptide binding specificities of HLA-B*5701 and B*5801.
23004006 2013 Chronic spontaneous urticaria: epidemiological characteristics focusing on the histocompatibility profile and presence of antibodies.
22997432 2012 HLA-B7-restricted islet epitopes are differentially recognized in type 1 diabetic children and adults and form weak peptide-HLA complexes.
22981956 2013 [Susceptibility genes, HLA and diabetic retinopathy in the Algerian population].
22933291 2012 Temporal association of HLA-B*81:01- and HLA-B*39:10-mediated HIV-1 p24 sequence evolution with disease progression.
22931407 2012 HLA-B*15:02 is associated with anemia in patients with chronic hepatitis C treated with pegylated interferon-? and ribavirin.
22925811 2013 Susceptibility to chronic hepatitis C virus infection is influenced by sequence differences in immunodominant CD8+ T cell epitopes.
22923333 2012 Molecular architecture of the MHC I peptide-loading complex: one tapasin molecule is essential and sufficient for antigen processing.
22918227 2012 Functional interaction of the ankylosing spondylitis-associated endoplasmic reticulum aminopeptidase 1 polymorphism and HLA-B27 in vivo.
22909208 2012 HLA-B*58:01 allele is associated with augmented risk for both mild and severe cutaneous adverse reactions induced by allopurinol in Han Chinese.
22896606 2012 HIV control through a single nucleotide on the HLA-B locus.
22887649 2013 Epistasis between two HLA antigens defines a subset of individuals at a very high risk for ankylosing spondylitis.
22833576 2012 HLA-B*1502 screening in carbamazepine and lamotrigine candidates of Asian background.
22833469 2013 Assessment of SpondyloArthritis International Society criteria for axial spondyloarthritis in chronic back pain patients with a high prevalence of HLA-B27.
22826228 2012 HLA-B may be more protective against HIV-1 than HLA-A because it resists negative regulatory factor (Nef) mediated down-regulation.
22818943 2012 Cutaneous reactions induced by oxcarbazepine in Southern Han Chinese: incidence, features, risk factors and relation to HLA-B alleles.
22818666 2013 HLA class I protective alleles in an HIV-1-infected subject homozygous for CCR5-?32/?32.
22811530 2012 HLA class I-mediated control of HIV-1 in the Japanese population, in which the protective HLA-B*57 and HLA-B*27 alleles are absent.
22811521 2012 Early HLA-B*57-restricted CD8+ T lymphocyte responses predict HIV-1 disease progression.
22808100 2012 Functional differences exist between TNF? promoters encoding the common -237G SNP and the rarer HLA-B*5701-linked A variant.
22807446 2012 Characterization of a proteasome and TAP-independent presentation of intracellular epitopes by HLA-B27 molecules.
22795247 2012 Genetic HLA associations in complex regional pain syndrome with and without dystonia.
22786832<