Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.39
PubTator Score 1.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.1e-117
osteosarcoma 7950 1.9e-06
ovarian cancer 8520 7.5e-04
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Transient myeloproliferative syndrome 7 3.955 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.447 1.9e-06
ovarian cancer -1.100 7.5e-04
psoriasis 1.100 2.1e-117

Gene RIF (2)

AA Sequence

MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVEINSSSRSHVL      1 - 70
VWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLP     71 - 140
FNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDIDQQYLNYIFSVVLLAFASHPTGDLFSVLDFP    141 - 210
FLYFYRFHGSCCASGFLGFFLMFSTVKLKNLLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLL    211 - 280
GALGEALLVFSERKSS                                                          281 - 296
//

Text Mined References (10)

PMID Year Title