Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.39
PubTator Score 1.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.447 0.000
ovarian cancer -1.100 0.001
psoriasis 1.100 0.000

Gene RIF (1)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVEINSSSRSHVL      1 - 70
VWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLP     71 - 140
FNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDIDQQYLNYIFSVVLLAFASHPTGDLFSVLDFP    141 - 210
FLYFYRFHGSCCASGFLGFFLMFSTVKLKNLLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLL    211 - 280
GALGEALLVFSERKSS                                                          281 - 296
//

Text Mined References (9)

PMID Year Title
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23027870 2012 Hyperactivity of the Ero1? oxidase elicits endoplasmic reticulum stress but no broad antioxidant response.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.