Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.42
PubTator Score 181.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
osteosarcoma 2.028 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.200 0.001
adrenocortical carcinoma 1.361 0.000
non-small cell lung cancer 1.721 0.000
breast carcinoma 1.600 0.001
fibroadenoma 1.900 0.004
pediatric high grade glioma -1.100 0.001
atypical teratoid/rhabdoid tumor -1.100 0.001
group 4 medulloblastoma -1.100 0.000
lung adenocarcinoma 2.100 0.000
Breast cancer 1.500 0.000
ductal carcinoma in situ 1.700 0.006
invasive ductal carcinoma 2.100 0.001

Synonym

Accession Q24JP5 Q69YU7 Q86VZ8 Q86W97 Q9H8K3 Q9HCI9 Q9NWY0
Symbols GBP
HSPA5BP1

Gene

Pathway (1)

Gene RIF (2)

PMID Text
18854154 Knockdown of transmembrane protein 132A (TMEM132A; HSPA5BP1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12514190 describes characterization of the rat protein

AA Sequence

MCARMAGRTTAAPRGPYGPWLCLLVALALDVVRVDCGQAPLDPVYLPAALELLDAPEHFRVQQVGHYPPA      1 - 70
NSSLSSRSETFLLLQPWPRAQPLLRASYPPFATQQVVPPRVTEPHQRPVPWDVRAVSVEAAVTPAEPYAR     71 - 140
VLFHLKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPSLGACVVELELPSHWFSQASTTRAELAYTLE    141 - 210
PAAEGPGGCGSGEENDPGEQALPVGGVELRPADPPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHN    211 - 280
FTASLLTLRIKVKKGLHVTAARPAQPTLWTAKLDRFKGSRHHTTLITCHRAGLTEPDSSPLELSEFLWVD    281 - 350
FVVENSTGGGVAVTRPVTWQLEYPGQAPEAEKDKMVWEILVSERDIRALIPLAKAEELVNTAPLTGVPQH    351 - 420
VPVRLVTVDGGGALVEVTEHVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWRRLRASLRLTV    421 - 490
WAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASDEAERRARGCHLQYQRAGVRFLAPFAAHPLD    491 - 560
GGRRLTHLLGPDWLLDVSHLVAPHARVLDSRVASLEGGRVVVGREPGVTSIEVRSPLSDSILGEQALAVT    561 - 630
DDKVSVLELRVQPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRR    631 - 700
DLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPAS    701 - 770
TPAPALPSSPAWSPPATEATMGGKRQVAGSVGGNTGVRGKFERAEEEARKEETEAREEEEEEEEEMVPAP    771 - 840
QHVTELELGMYALLGVFCVAIFIFLVNGVVFVLRYQRKEPPDSATDPTSPQPHNWVWLGTDQEELSRQLD    841 - 910
RQSPGPPKGEGSCPCESGGGGEAPTLAPGPPGGTTSSSSTLARKEAGGRRKRVEFVTFAPAPPAQSPEEP    911 - 980
VGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIRGSS                               981 - 1023
//

Text Mined References (11)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16806201 2006 GRP78-binding protein regulates cAMP-induced glial fibrillary acidic protein expression in rat C6 glioblastoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12514190 2003 Cloning and characterization of a novel GRP78-binding protein in the rat brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11524435 2001 Physiological regulation of [beta]-catenin stability by Tcf3 and CK1epsilon.
More...