Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.47
PubTator Score 181.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.361 1.7e-05
adult high grade glioma -1.100 1.4e-04
atypical teratoid/rhabdoid tumor -1.100 8.2e-04
Breast cancer 1.500 3.7e-09
breast carcinoma 1.600 1.4e-03
ductal carcinoma in situ 1.700 6.0e-03
fibroadenoma 1.900 3.7e-03
glioblastoma -1.100 4.4e-05
group 4 medulloblastoma -1.100 2.2e-04
invasive ductal carcinoma 2.100 1.4e-03
lung adenocarcinoma 2.100 7.6e-07
malignant mesothelioma -1.600 8.2e-07
medulloblastoma, large-cell -1.200 1.1e-03
non-small cell lung cancer 1.721 5.8e-26
osteosarcoma 1.326 2.2e-03

Gene RIF (2)

AA Sequence

MCARMAGRTTAAPRGPYGPWLCLLVALALDVVRVDCGQAPLDPVYLPAALELLDAPEHFRVQQVGHYPPA      1 - 70
NSSLSSRSETFLLLQPWPRAQPLLRASYPPFATQQVVPPRVTEPHQRPVPWDVRAVSVEAAVTPAEPYAR     71 - 140
VLFHLKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPSLGACVVELELPSHWFSQASTTRAELAYTLE    141 - 210
PAAEGPGGCGSGEENDPGEQALPVGGVELRPADPPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHN    211 - 280
FTASLLTLRIKVKKGLHVTAARPAQPTLWTAKLDRFKGSRHHTTLITCHRAGLTEPDSSPLELSEFLWVD    281 - 350
FVVENSTGGGVAVTRPVTWQLEYPGQAPEAEKDKMVWEILVSERDIRALIPLAKAEELVNTAPLTGVPQH    351 - 420
VPVRLVTVDGGGALVEVTEHVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWRRLRASLRLTV    421 - 490
WAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASDEAERRARGCHLQYQRAGVRFLAPFAAHPLD    491 - 560
GGRRLTHLLGPDWLLDVSHLVAPHARVLDSRVASLEGGRVVVGREPGVTSIEVRSPLSDSILGEQALAVT    561 - 630
DDKVSVLELRVQPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRR    631 - 700
DLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPAS    701 - 770
TPAPALPSSPAWSPPATEATMGGKRQVAGSVGGNTGVRGKFERAEEEARKEETEAREEEEEEEEEMVPAP    771 - 840
QHVTELELGMYALLGVFCVAIFIFLVNGVVFVLRYQRKEPPDSATDPTSPQPHNWVWLGTDQEELSRQLD    841 - 910
RQSPGPPKGEGSCPCESGGGGEAPTLAPGPPGGTTSSSSTLARKEAGGRRKRVEFVTFAPAPPAQSPEEP    911 - 980
VGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIRGSS                               981 - 1023
//

Text Mined References (11)

PMID Year Title