Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.32
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.600 0.000
pediatric high grade glioma -1.200 0.000
group 4 medulloblastoma -1.200 0.001

AA Sequence

MALLLCLVCLTAALAHGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDTMKELHLAIPA      1 - 70
KITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNAIIESRIDCQHRCGIFQYETI     71 - 140
SCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQDTSMRPRSSAFSWPGTHRATPAFLVSPALR    141 - 210
CLEPPHLANLTLEDAAECLKQH                                                    211 - 232
//

Text Mined References (7)

PMID Year Title
22957301 2012 Positive Selection and the Evolution of izumo Genes in Mammals.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19658160 2009 Izumo is part of a multiprotein family whose members form large complexes on mammalian sperm.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.