Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.32
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 1.9e-03
glioblastoma -1.200 7.8e-05
group 4 medulloblastoma -1.200 8.0e-04
medulloblastoma, large-cell -1.600 2.9e-06

Synonym

Accession Q1ZYL8 A7RA93 A7RA94 Q6UXA2 Q96FT6 Q96L02
Symbols C19orf36
IMAGE:4215339

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MALLLCLVCLTAALAHGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDTMKELHLAIPA      1 - 70
KITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNAIIESRIDCQHRCGIFQYETI     71 - 140
SCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQDTSMRPRSSAFSWPGTHRATPAFLVSPALR    141 - 210
CLEPPHLANLTLEDAAECLKQH                                                    211 - 232
//

Text Mined References (7)

PMID Year Title