Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 1.5e-04
osteosarcoma 7950 1.5e-04
group 3 medulloblastoma 4104 5.0e-03
astrocytic glioma 2597 1.7e-02
primitive neuroectodermal tumor 3035 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Synonym

Accession Q1XH10 B1ANA5 Q6ZMX4 Q8N3C3
Symbols DLN-1
C10orf140

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELRKLKAI      1 - 70
NSIAFHAAKCTLISREDVEALYTSCKTERVLKTKRRRVGRALATKAPPPERAAAASPRPGFWKDKHQLWR     71 - 140
GLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSHYPEIVRSPCKPPLNYETAPLQGNYVAFPSD    141 - 210
PAYFRSLLCSKHPAAAAAAAAAAAAAAGATCLERFHLVNGFCPPPHHHHHHHHHHHHHHHRAQPPQQSHH    211 - 280
PPHHHRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGSSLSSSSNSVSSEEEEEEGEEEEEEEEEEGGS    281 - 350
GASDSSEVSSEEEDSSTESDSSSGSSQVSVQSIRFRRTSFCKPPSVQAQANFLYHLASAAAATKPAAFED    351 - 420
AGRLPDLKSSVKAESPAEWNLQSWAPKASPVYCPASLGSCFAEIRNDRVSEITFPHSEISNAVKRTDLTI    421 - 490
NCLAEGASSPSPKTNNAFPQQRILREARKCLQTTPTTHCADNNTIAARFLNNDSSGAEANSEKYSKILHC    491 - 560
PEFATDLPSSQTDPEVNAAGAAATKAENPCTDTGDKTLPFLHNIKIKVEDSSANEEYEPHLFTNKLKCEC    561 - 630
NDTKGEFYSVTESKEEDALLTTAKEGFACPEKETPSLNPLAQSQGLSCTLGSPKPEDGEYKFGARVRKNY    631 - 700
RTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETNEGTLDDFTVINRRKKVASNVASAVKRPFHFMANFP    701 - 770
CPPSLIIGRDGDLWPAYSLNTTKDSQTPHKAHPIWKWQLGGSAIPLPPSHKFRKFNS                 771 - 827
//

Text Mined References (9)

PMID Year Title