Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.02
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.800 0.001
oligodendroglioma -2.500 0.005
posterior fossa group B ependymoma 3.400 0.000
group 3 medulloblastoma -2.500 0.002
glioblastoma -2.000 0.002
medulloblastoma, large-cell -2.900 0.001
primitive neuroectodermal tumor -2.300 0.019
Atopic dermatitis 1.100 0.007
fibroadenoma 1.800 0.007
interstitial cystitis -3.800 0.000
pediatric high grade glioma -1.600 0.001
psoriasis 2.100 0.000
Endometriosis -2.451 0.013
ductal carcinoma in situ 2.500 0.001
invasive ductal carcinoma 2.700 0.003
ovarian cancer -2.400 0.000
pituitary cancer -2.100 0.001

Synonym

Accession Q1W6H9
Symbols

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
19698782 Depletion of FAM110C by short interfering RNA reduced integrin-mediated filopodia formation, hepatocyte growth factor-induced migration, and phosphorylation of the Akt1 kinase in the epithelial cell line HepG2.
17499476 Ectopic eexpression impairs cell cycle progression through the G1 phase; overexpression induces aberrant microtubules.

AA Sequence

MRALAALSAPPNERLLPRDPAATRDPDAARPARRSAVERLAADRAKYVRGRPGTGRGVASEGSGPGAIKC      1 - 70
PGNDPGPPARAPAPVARRAIARKPLRPDSLIIYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRT     71 - 140
GDEGKAGNPETVPTTPGPAADPAIPETPAPAARSAAPSSVPAAPPGPEPRVVRRRGLQRSQSDLSSRYSA    141 - 210
ALAESDTFFQYCGLDPEVVEALGRENFTAGSDCVTLKVRSVSVATSGSGFSRHSGGDDEGLQEEELIEQV    211 - 280
PSTTSVIERNARIIKWLYTCKKAKETPSQEQSRTRGSKPSR                                 281 - 321
//

Text Mined References (5)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
19698782 2009 Evidence for the involvement of FAM110C protein in cell spreading and migration.
17499476 2007 Characterization of the FAM110 gene family.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.