Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.07
PubTator Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
adrenocortical carcinoma 1427 0.00180003441039425
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0393398142145717
Disease Target Count Z-score Confidence
Acute monocytic leukemia 11 4.108 2.1

Expression

  Differential Expression (2)

Synonym

Accession Q1W4C9 A1A4Y2
Symbols LiESP6
SPINK5L3
HESPINTOR
HBVDNAPTP1

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid

AA Sequence

MAAFPHKIIFFLVCSTLTHVAFSGIFNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQN      1 - 70
ECFFCVEQREFHYRIKFEKYGKCD                                                   71 - 94
//

Text Mined References (6)

PMID Year Title
23430248 2013 Spink13, an epididymis-specific gene of the Kazal-type serine protease inhibitor (SPINK) family, is essential for the acrosomal integrity and male fertility.
18390568 2008 Transcriptome analysis of a cDNA library from adult human epididymis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.