Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.07
PubTator Score 2.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Synonym

Accession Q1W4C9 A1A4Y2
Symbols LiESP6
SPINK5L3
HESPINTOR
HBVDNAPTP1

Gene

AA Sequence

MAAFPHKIIFFLVCSTLTHVAFSGIFNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQN      1 - 70
ECFFCVEQREFHYRIKFEKYGKCD                                                   71 - 94
//

Text Mined References (6)

PMID Year Title
23430248 2013 Spink13, an epididymis-specific gene of the Kazal-type serine protease inhibitor (SPINK) family, is essential for the acrosomal integrity and male fertility.
18390568 2008 Transcriptome analysis of a cDNA library from adult human epididymis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.