Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.07
PubTator Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma 2.229 1.8e-03
intraductal papillary-mucinous adenoma (... 1.400 3.9e-02

AA Sequence

MAAFPHKIIFFLVCSTLTHVAFSGIFNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQN      1 - 70
ECFFCVEQREFHYRIKFEKYGKCD                                                   71 - 94
//

Text Mined References (6)

PMID Year Title