Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q1W209 hES cell-related gene protein
Symbols HESRG

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (3)

PMID Text
23628413 Data indicate that the embryonic stem cell related gene (ESRG) protein was located in the nuclei of embryonic stem cells (hESCs).
21861197 HESRG is a novel, sensitive and specific biomarker for intracranial germinoma and embryonal carcinoma.
17803967 The above suggested an important role for the novel HESRG gene in supporting the undifferentiated state or self-renewal of hES cells.

AA Sequence

MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVL      1 - 70
RPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKT     71 - 140
PAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGA    141 - 210
GASTPQPLLLHP                                                              211 - 222
//

Text Mined References (4)

PMID Year Title
23628413 2013 Identification, expression and subcellular localization of ESRG.
21861197 2012 HESRG: a novel biomarker for intracranial germinoma and embryonal carcinoma.
17803967 2007 Transcriptional profiling of human embryonic stem cells and embryoid bodies identifies HESRG, a novel stem cell gene.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.