Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (3)

AA Sequence

MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVL      1 - 70
RPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKT     71 - 140
PAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGA    141 - 210
GASTPQPLLLHP                                                              211 - 222
//

Text Mined References (5)

PMID Year Title