Knowledge Summary

Patent

No data available

Synonym

Accession Q1T7F1
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MPLSDWCCGICEEAPLGRAYTQTWMETGCGPHGVTALGQQELKDCLRARSGGTASSVDWIMEAARGSLNV      1 - 70
HNCLIKFGRRD                                                                71 - 81
//

Text Mined References (2)

PMID Year Title
22586462 2012 3D profile-based approach to proteome-wide discovery of novel human chemokines.
15057824 2004 The DNA sequence and biology of human chromosome 19.