Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.97
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3577 2.9e-13
ovarian cancer 8519 2.8e-07
medulloblastoma 720 1.2e-04
osteosarcoma 7950 1.7e-02
Rheumatoid arthritis 1191 2.8e-02
sarcoidosis 370 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Specific developmental disorder 9 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.100 2.9e-13
medulloblastoma 1.100 1.2e-04
osteosarcoma -1.222 1.7e-02
ovarian cancer -1.600 2.8e-07
Rheumatoid arthritis 1.300 2.8e-02
sarcoidosis 1.100 3.9e-02

Synonym

Accession Q1RMZ1 Q8N3D0 Q96MV7
Symbols SAMTOR
C7orf60

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MEPGAGGRNTARAQRAGSPNTPPPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDEET      1 - 70
LCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNMHESSQ     71 - 140
LEGHLTNLSFTNPEFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQ    141 - 210
PLQLAQDAIDAFLKQLKNPIDSLPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDS    211 - 280
SHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKISLKTTSDLVSRNYPGMLYIPQDFNSIEDE    281 - 350
EYSNPSCYVRSDIEDEQLAYGFTELPDAPYDSDSGESQASSIPFYELEDPILLLS                   351 - 405
//

Text Mined References (9)

PMID Year Title