Property Summary

NCBI Gene PubMed Count 11
PubMed Score 62.26
PubTator Score 40.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (2)

Disease log2 FC p
active ulcerative colitis 2.188 4.6e-02
intraductal papillary-mucinous neoplasm ... 1.400 5.1e-03

Gene RIF (5)

AA Sequence

MRRPPGNGEAASEGPGGWGLWGVQESRRLCCAGHDRCKQALLQIGINMMALPGGRHLDSVTLPGQRLHLM      1 - 70
QVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDAQGDLILAGGPGPGDPLQLLLKRGWVISTELRRIGQ     71 - 140
KLAQDRWARVHSMSVRLTCHARSMVSEYSAVSRNSLKEMGEIEKLLMEKCSELSAVTERCLQVENEHVLK    141 - 210
SMKACVSETLSMLGQHFGQLLELALTREVQALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEG    211 - 280
GVVALFKVCRQDSFRCLYPQALRTLASICCVEEGVHQLEKVDGVLCLADILTDNSHSEATRAEAAAVVAQ    281 - 350
VTSPHLPVTQHLSSFLESMEEIVTALVKLCQEASSGEVFLLASAALANITFFDTMACEMLLQLNAIRVLL    351 - 420
EACSDKQRVDTPYTRDQIVTILANMSVLEQCASDIIQENGVQLIMGMLSEKPRSGTPAEVAACERVQQKA    421 - 490
AVTLARLSRDPDVAREAVRLSCMSRLIELCRSPSERNSSDAVLVACLAALRRLAGVCPEGLQDSDFQQLV    491 - 560
QPRLVDSFLLCSNMEESFV                                                       561 - 579
//

Text Mined References (13)

PMID Year Title