Property Summary

NCBI Gene PubMed Count 11
Grant Count 12
R01 Count 4
Funding $14,217,819.2
PubMed Score 54.89
PubTator Score 40.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.400 0.005
ulcerative colitis 2.900 0.000

Gene RIF (5)

PMID Text
22977735 Studies indicate that the Inscuteable (Insc)and NuMA are mutually exclusive interactors of LGN.
22074847 mInsc-LGN interaction is vital for stabilization of LGN and for intracellular localization of mInsc.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20065032 These data present AGS3, G-proteins, and mInsc as candidate proteins involved in regulating cellular stress associated with protein-processing pathologies.
16458856 cloning of two distinct cDNAs from Insc gene, which is differentially expressed from alternative first exons;Insc proteins bind to the Pins homologues LGN and AGS3, and also to Par3 and Par3beta

AA Sequence

MRRPPGNGEAASEGPGGWGLWGVQESRRLCCAGHDRCKQALLQIGINMMALPGGRHLDSVTLPGQRLHLM      1 - 70
QVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDAQGDLILAGGPGPGDPLQLLLKRGWVISTELRRIGQ     71 - 140
KLAQDRWARVHSMSVRLTCHARSMVSEYSAVSRNSLKEMGEIEKLLMEKCSELSAVTERCLQVENEHVLK    141 - 210
SMKACVSETLSMLGQHFGQLLELALTREVQALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEG    211 - 280
GVVALFKVCRQDSFRCLYPQALRTLASICCVEEGVHQLEKVDGVLCLADILTDNSHSEATRAEAAAVVAQ    281 - 350
VTSPHLPVTQHLSSFLESMEEIVTALVKLCQEASSGEVFLLASAALANITFFDTMACEMLLQLNAIRVLL    351 - 420
EACSDKQRVDTPYTRDQIVTILANMSVLEQCASDIIQENGVQLIMGMLSEKPRSGTPAEVAACERVQQKA    421 - 490
AVTLARLSRDPDVAREAVRLSCMSRLIELCRSPSERNSSDAVLVACLAALRRLAGVCPEGLQDSDFQQLV    491 - 560
QPRLVDSFLLCSNMEESFV                                                       561 - 579
//

Text Mined References (13)

PMID Year Title
25226531 2014 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22977735 2012 On the inscrutable role of Inscuteable: structural basis and functional implications for the competitive binding of NuMA and Inscuteable to LGN.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22074847 2011 Structural basis for interaction between the conserved cell polarity proteins Inscuteable and Leu-Gly-Asn repeat-enriched protein (LGN).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20065032 2010 Distribution of activator of G-protein signaling 3 within the aggresomal pathway: role of specific residues in the tetratricopeptide repeat domain and differential regulation by the AGS3 binding partners Gi(alpha) and mammalian inscuteable.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16458856 2006 Two forms of human Inscuteable-related protein that links Par3 to the Pins homologues LGN and AGS3.
More...