Property Summary

NCBI Gene PubMed Count 4
PubMed Score 20.72
PubTator Score 7.44

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL      1 - 70
HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS      71 - 139
//

Text Mined References (5)

PMID Year Title