Property Summary

NCBI Gene PubMed Count 4
Grant Count 17
R01 Count 14
Funding $2,353,241.52
PubMed Score 14.64
PubTator Score 7.44

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
24442440 these data collectively suggest that PSMP is a chemoattractant protein acting as a novel CCR2 ligand that may influence inflammation and cancer development.

AA Sequence

MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL      1 - 70
HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS      71 - 139
//

Text Mined References (5)

PMID Year Title
24442440 2014 PC3-secreted microprotein is a novel chemoattractant protein and functions as a high-affinity ligand for CC chemokine receptor 2.
17338636 2007 A highly conserved protein secreted by the prostate cancer cell line PC-3 is expressed in benign and malignant prostate tissue.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11053263 2000 Characterization of gene expression in human trabecular meshwork using single-pass sequencing of 1060 clones.