Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.964 2.7e-03
adult high grade glioma -2.400 9.0e-05
Amyotrophic lateral sclerosis 1.265 8.1e-06
astrocytic glioma -1.800 1.0e-02
Astrocytoma, Pilocytic -1.700 9.0e-06
atypical teratoid / rhabdoid tumor -1.700 2.0e-03
chronic rhinosinusitis -1.067 8.8e-03
Duchenne muscular dystrophy -1.025 4.3e-05
ependymoma -2.200 3.5e-02
glioblastoma -1.900 2.7e-06
group 3 medulloblastoma -3.600 1.1e-03
intraductal papillary-mucinous carcinoma... -2.000 1.8e-02
invasive ductal carcinoma -1.452 1.9e-02
limb girdle muscular dystrophy 2B -1.023 8.4e-04
lung carcinoma 2.000 2.0e-27
medulloblastoma, large-cell -4.000 1.2e-03
oligodendroglioma -1.600 1.5e-15
ovarian cancer -3.400 3.5e-05
pancreatic cancer -1.400 7.7e-04
Pick disease 1.500 1.7e-02
primitive neuroectodermal tumor -1.200 6.0e-03
psoriasis -1.400 1.1e-49

Gene RIF (2)

AA Sequence

MSPEPVPPPPPPQCPGCDRAEPIAQRLEEGDEAFRAGDYEMAAELFRSMLAGLAQPDRGLCLRLGDALAR      1 - 70
AGRLPEALGAFRGAARLGALRPEELEELAGGLVRAVGLRDRPLSAENPGGEPEAPGEGGPAPEPRAPRDL     71 - 140
LGCPRCRRLLHKPVTLPCGLTVCKRCVEPGPARPQVRRVNVVLSGLLEKCFPAECRLRRLAGQARSLQRQ    141 - 210
QQPEAALLRCDQALELAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGR    211 - 280
SKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGD    281 - 350
AGSSENSSEKSDMLGNTNSSVLYFILGLHFEEDKKALESILPTAPSAGLKRQFPDDVEDAPDLNAPGKIP    351 - 420
KKDLSLQRSPNSETEESQGLSLDVTDFECALCMRLLFEPVTTPCGHTFCLKCLERCLDHAPHCPLCKDKL    421 - 490
SELLASRNFNITVLAEELIFRYLPDELSDRKRIYDEEMSELSNLTRDVPIFVCAMAFPTVPCPLHVFEPR    491 - 560
YRLMIRRCMETGTKRFGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHRDGYNT    561 - 630
ADIEYLEDEKVEGPEYEELAALHDSVHQQSVSWFASLQDRMKEQILSHFGVMPDREPEPQSNPSGPAWSW    631 - 700
WILAVLPLERKAQLAILGMTSLKERLLAIRRILVIITRKMNSRQELANARERNN                    701 - 754
//

Text Mined References (6)

PMID Year Title