Property Summary

NCBI Gene PubMed Count 19
Grant Count 13
R01 Count 10
Funding $1,140,788.25
PubMed Score 45.52
PubTator Score 30.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.112 0.000
Atopic dermatitis 1.500 0.000
non-small cell lung cancer -1.406 0.000
interstitial cystitis -2.900 0.000
psoriasis 1.400 0.000
lung adenocarcinoma -2.800 0.000
Endometriosis -1.675 0.047
lung carcinoma -1.800 0.000
spina bifida -1.062 0.032
gastric carcinoma -1.700 0.009

Gene RIF (2)

PMID Text
19339556 Heterodimerization controls localization of Duox-DuoxA NADPH oxidases in airway cells.
19322654 DUOXA1 transient overexpression affected the cell-cell adhesion by modulating the actin cytoskeleton

AA Sequence

MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAV      1 - 70
NFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAE     71 - 140
EYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYML    141 - 210
LATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLK    211 - 280
AFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL           281 - 343
//

Text Mined References (19)

PMID Year Title
23033809 2013 Sexual dimorphism of thyroid reactive oxygen species production due to higher NADPH oxidase 4 expression in female thyroid glands.
23010498 2013 Thyroid hydrogen peroxide production is enhanced by the Th2 cytokines, IL-4 and IL-13, through increased expression of the dual oxidase 2 and its maturation factor DUOXA2.
22874065 2012 Regulation of dual oxidase expression and H2O2 production by thyroglobulin.
22814254 2012 The type of DUOX-dependent ROS production is dictated by defined sequences in DUOXA.
21367925 2011 A single copy of the recently identified dual oxidase maturation factor (DUOXA) 1 gene produces only mild transient hypothyroidism in a patient with a novel biallelic DUOXA2 mutation and monoallelic DUOXA1 deletion.
21362455 2011 p53-mediated regulation of neuronal differentiation via regulation of dual oxidase maturation factor 1.
20826581 2010 Functional consequences of dual oxidase-thyroperoxidase interaction at the plasma membrane.
20407074 2010 Dual oxidase, hydrogen peroxide and thyroid diseases.
20122987 2010 Defects of thyroidal hydrogen peroxide generation in congenital hypothyroidism.
20060878 2010 Delimitation and functional characterization of the bidirectional THOX-DUOXA promoter regions in thyrocytes.
More...