Property Summary

NCBI Gene PubMed Count 20
PubMed Score 49.06
PubTator Score 30.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Hypothyroidism 122 3.623 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis 1.300 1.4e-03
Endometriosis -1.675 4.7e-02
gastric carcinoma -1.700 8.7e-03
interstitial cystitis -2.500 3.3e-04
lung adenocarcinoma -2.800 2.8e-11
lung carcinoma -1.800 3.1e-30
non-small cell lung cancer -1.406 5.2e-17
osteosarcoma 1.112 2.5e-06
psoriasis 1.200 7.2e-33
spina bifida -1.062 3.2e-02

Gene RIF (3)

AA Sequence

MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAV      1 - 70
NFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAE     71 - 140
EYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYML    141 - 210
LATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLK    211 - 280
AFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL           281 - 343
//

Text Mined References (20)

PMID Year Title