Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.47
PubTator Score 0.50

Knowledge Summary

Patent

No data available

AA Sequence

MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYADSDLAVVRSGRVKKAVANAVRQEVKSL      1 - 70
CGLEASQVPAEEALSGAGEPYDIIDSSDEMDAQEENIHERTVSRKKKSKRHKEELDGAGGEEYPMDIWLL     71 - 140
LASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLHCLRACVIRSLYHM    141 - 210
YEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQ    211 - 280
YEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGV    281 - 350
QVILDPVHSVRLFDWWHPQYPFSLRA                                                351 - 376
//

Text Mined References (1)

PMID Year Title
16644869 2006 Origination and evolution of a human-specific transmembrane protein gene, c1orf37-dup.