Property Summary

NCBI Gene PubMed Count 3
PubMed Score 12.09
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MMILVFWSNYPYEPVCLASHRNNMEASVPKYKKHLPQLGMQKEMEQDVKRFGQAAWATAIPRLEKLKLML      1 - 70
AQETLQLMRAKELCLNHKRAEIQGKMEDLPEQEKNINVVDELAIQFYEIQLELYEVKFEILKNKEILLTT     71 - 140
QLDSLERLIKDEI                                                             141 - 153
//

Text Mined References (4)

PMID Year Title