Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.85
PubTator Score 39.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 4.2e-16
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.3
Celiac disease 116 0.0 1.4
Disease Target Count Z-score Confidence
Neurofibromatosis 40 3.099 1.5

Synonym

Accession Q1A5X6 B7ZMM2 B9EH97 Q1A5X5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKR      1 - 70
SPSPPSVSSEKLSSSVSMNTFSDSSTPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTG     71 - 140
FIHTLKEPQIERLGFLTLQ                                                       141 - 159
//

Text Mined References (9)

PMID Year Title