Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.10
PubTator Score 298.72

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MGTAGAMQLCWVILGFLLFRGHNSQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTG      1 - 70
TPGAGVPSSGRDGGTSRDTFQTVPPNSTTMSLSMREDATILPSPTSETVLTVAAFGVISFIVILVVVVII     71 - 140
LVGVVSLRFKCRKSKESEDPQKPGSSGLSESCSTANGEKDSITLISMKNINMNNGKQSLSAEKVL         141 - 205
//

Text Mined References (18)

PMID Year Title