Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.97
PubTator Score 298.72

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
23393131 Endothelial cell-specific chemotaxis receptor (ECSCR) enhances vascular endothelial growth factor (VEGF) receptor-2/kinase insert domain receptor (KDR) activation and promotes proteolysis of internalized KDR.
23147565 identification of three novel full-length splice variants potentially encoding different protein isoforms
21720547 ECSM2 modulated bFGF-directed endothelial cell motility via the FGF receptor (FGFR)-extracellular regulated kinase (ERK)-focal adhesion kinase (FAK) pathway.
19416853 Knockdown of ARIA in HUVECs significantly reduced endothelial apoptosis without affecting either cell migration or proliferation. ARIA knockdown significantly increased inhibitor of apoptosis cIAP-1 and cIAP-2 protein expression
19267780 ECSM2 is involved in cell-shape changes and actin cytoskeletal rearrangement, suppresses tyrosine phosphorylation signaling and ECSM2 can cross-talk with EGFR to attenuate the EGF-induced cell migration.
19240791 Observational study of gene-disease association. (HuGE Navigator)
18556573 Characterize a novel cell surface protein ECSM2 that regulates endothelial chemotaxis and tube formation, and interacts with filamin A.

AA Sequence

MGTAGAMQLCWVILGFLLFRGHNSQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTG      1 - 70
TPGAGVPSSGRDGGTSRDTFQTVPPNSTTMSLSMREDATILPSPTSETVLTVAAFGVISFIVILVVVVII     71 - 140
LVGVVSLRFKCRKSKESEDPQKPGSSGLSESCSTANGEKDSITLISMKNINMNNGKQSLSAEKVL         141 - 205
//

Text Mined References (16)

PMID Year Title
23909426 2013 Preparation of anti-hECSM2 mouse monoclonal antibodies and their application in the analysis of hECSM2 expression.
23664449 2013 Favorable prognosis of operable non-small cell lung cancer (NSCLC) patients harboring an increased expression of tumor endothelial markers (TEMs).
23393131 2013 Endothelial cell-specific chemotaxis receptor (ECSCR) enhances vascular endothelial growth factor (VEGF) receptor-2/kinase insert domain receptor (KDR) activation and promotes proteolysis of internalized KDR.
23147565 2012 Identification of novel splice variants and exons of human endothelial cell-specific chemotaxic regulator (ECSCR) by bioinformatics analysis.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22103489 2011 Shear stress, tip cells and regulators of endothelial migration.
21720547 2011 Endothelial cell-specific molecule 2 (ECSM2) localizes to cell-cell junctions and modulates bFGF-directed cell migration via the ERK-FAK pathway.
19909249 2009 Functionally defining the endothelial transcriptome, from Robo4 to ECSCR.
19416853 2009 Identification of ARIA regulating endothelial apoptosis and angiogenesis by modulating proteasomal degradation of cIAP-1 and cIAP-2.
19267780 2009 Endothelial cell-specific molecule 2 (ECSM2) modulates actin remodeling and epidermal growth factor receptor signaling.
More...