Property Summary

NCBI Gene PubMed Count 5
Grant Count 18
R01 Count 17
Funding $3,700,157.83
PubMed Score 0.20
PubTator Score 18.18

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLFGSSATQALDLVDRQSITLISSPSGRRVYQVLG      1 - 70
SSSKTYTCLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA     71 - 140
//

Text Mined References (5)

PMID Year Title
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
16710300 2006 Sws1 is a conserved regulator of homologous recombination in eukaryotic cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.