Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.53
PubTator Score 18.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

AA Sequence

MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLFGSSATQALDLVDRQSITLISSPSGRRVYQVLG      1 - 70
SSSKTYTCLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA     71 - 140
//

Text Mined References (5)

PMID Year Title