Property Summary

NCBI Gene PubMed Count 42
PubMed Score 98.60
PubTator Score 68.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 2.000 1.7e-04
lung adenocarcinoma -1.200 5.6e-04
ovarian cancer 1.200 3.9e-02
pituitary cancer -1.300 6.7e-03
psoriasis -2.100 4.6e-29

Gene RIF (21)

AA Sequence

MTEAALVEGQVKLRDGKKWKSRWLVLRKPSPVADCLLMLVYKDKSERIKGLRERSSLTLEDICGLEPGLP      1 - 70
YEGLVHTLAIVCLSQAIMLGFDSHEAMCAWDARIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDVLVL     71 - 140
ARDIPPAVTGQWKLSDLRRYGAVPSGFIFEGGTRCGYWAGVFFLSSAEGEQISFLFDCIVRGISPTKGPF    141 - 210
GLRPVLPDPSPPGPSTVEERVAQEALETLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSR    211 - 280
LTAWPEQSSSSASTSQEGPRPAAAQAAGEAMVGASRPPPKPLRPRQLQEVGRQSSSDSGIATGSHSSYSS    281 - 350
SLSSYAGSSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHSP    351 - 420
PSQGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQGSEATLPGPAPGEPWEAGGPHAGPPPAFFS    421 - 490
ACPVCGGLKVNPPP                                                            491 - 504
//

Text Mined References (42)

PMID Year Title