Property Summary

NCBI Gene PubMed Count 12
PubMed Score 41.87
PubTator Score 15.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma -1.400 1.3e-02
cystic fibrosis 1.819 1.2e-06
ductal carcinoma in situ -1.100 1.7e-02
lung adenocarcinoma 1.500 2.3e-02
non-small cell lung cancer 2.519 3.5e-11
osteosarcoma 2.097 2.7e-02
ovarian cancer 1.500 1.2e-02
spina bifida -2.432 3.6e-02
tuberculosis -3.100 4.2e-07

Gene RIF (7)

AA Sequence

MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIA      1 - 70
AVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSM     71 - 140
GESCGGLWLAILLLLASIAAGLSLS                                                 141 - 165
//

Text Mined References (15)

PMID Year Title