Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
Funding $46,504.25
PubMed Score 40.34
PubTator Score 15.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.097 0.027
cystic fibrosis 1.887 0.000
tuberculosis -3.100 0.000
non-small cell lung cancer 2.519 0.000
breast carcinoma -1.400 0.013
lung adenocarcinoma 1.500 0.023
spina bifida -2.432 0.036
ductal carcinoma in situ -1.100 0.017
ovarian cancer 1.500 0.012

Gene RIF (5)

PMID Text
22988241 AP-1 activation has an important role in promoting LY6K gene expression that regulates cell mobility of breast cancer cells
22072328 it appears that LY6K is constitutively overexpressed either by copy number changes, or by yet unknown mechanisms in gingivobuccal squamous cell carcinoma
20237496 Observational study of gene-disease association. (HuGE Navigator)
18089789 Useful as a tumor biomarker and probably as a target for the development of new molecular therapies for cancer treatment.
17784873 Data show that TTK protein kinase, lymphocyte antigen 6 complex locus K and insulin-like growth factor (IGF)-II mRNA binding protein 3 are tumor-associated antigens recognized by cytotoxic T lymphocytes and HLA-A24-restricted epitope peptides.

AA Sequence

MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIA      1 - 70
AVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSM     71 - 140
GESCGGLWLAILLLLASIAAGLSLS                                                 141 - 165
//

Text Mined References (13)

PMID Year Title
22988241 2012 The regulatory mechanism of the LY6K gene expression in human breast cancer cells.
22072328 2012 Genome-wide expression and copy number analysis identifies driver genes in gingivobuccal cancers.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18089789 2007 Cancer-testis antigen lymphocyte antigen 6 complex locus K is a serologic biomarker and a therapeutic target for lung and esophageal carcinomas.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17784873 2007 Identification of human leukocyte antigen-A24-restricted epitope peptides derived from gene products upregulated in lung and esophageal cancers as novel targets for immunotherapy.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...