Property Summary

NCBI Gene PubMed Count 37
PubMed Score 33.81
PubTator Score 18.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 1.200 5.6e-03
adult high grade glioma -1.100 1.6e-02
Amyotrophic lateral sclerosis 1.037 1.1e-04
Atopic dermatitis -1.100 9.8e-03
atypical teratoid / rhabdoid tumor -1.600 1.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.052 2.5e-02
Breast cancer 2.200 2.8e-02
glioblastoma -1.100 5.7e-04
group 3 medulloblastoma -1.600 6.8e-04
interstitial cystitis 1.500 4.7e-03
interstitial lung disease -1.100 4.9e-03
invasive ductal carcinoma 1.153 3.9e-02
juvenile dermatomyositis 1.196 1.9e-06
medulloblastoma, large-cell -2.600 1.2e-05
mucosa-associated lymphoid tissue lympho... 2.047 4.7e-03
osteosarcoma 2.089 1.7e-04
ovarian cancer -1.600 1.6e-05
pancreatic ductal adenocarcinoma liver m... -1.092 3.0e-03
permanent atrial fibrillation -1.200 3.4e-02
Pick disease 1.200 6.2e-03
Rheumatoid arthritis 2.000 2.4e-02
spina bifida -2.935 1.7e-02
ulcerative colitis 1.100 1.9e-04

Gene RIF (18)

AA Sequence

MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAWLFPAPATHNI      1 - 70
QDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDNSSENGNGKEKIRIESPVL     71 - 140
TGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPAASANNGALLFQNF    141 - 210
PHHVSPGFGGSFSPQIGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNK    211 - 280
PPSPWSSYQSPSPTPSSSWSPGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYAR    281 - 350
PSSAFAPKSWMEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINA    351 - 420
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITA    421 - 490
SFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP    491 - 560
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFS    561 - 630
NQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAA    631 - 700
IHSRAGREFHKPLVKEGGDRPRHISFRWN                                             701 - 729
//

Text Mined References (45)

PMID Year Title