Property Summary

NCBI Gene PubMed Count 31
Grant Count 2
Funding $82,260
PubMed Score 29.06
PubTator Score 18.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26627607 Identify a mechanism of VEGF overexpression in liver and mesentery that promotes pathologic, but not physiologic, angiogenesis, via sequential and nonredundant functions of CPEB1 and CPEB4.
26398195 CPEB1, 2, and 4, are essential to successful mitotic cell division.
26361147 findings imply that posttranscriptional deregulation of CPEB4 contributes to the inhibited cell proliferation and the enhanced cell apoptosis in colorectal cancer, and directly targeting CPEB4 by miR-203 might be a strategy in colorectal cancer treatment
26209100 These results suggested that the miR-1246 may promote cell metastasis by targeting CPEB4
25081215 Evidence that CPEB4 uses both its RNA recognition motifs to maintain optimal RNA binding.
24045092 CPEB4 is a candidate biomarker for defining metastatic cancers and directing personalized therapies.
23145039 Knockdown of CPEB4 expression significantly facilitated HCC cell migration and invasion.
22138752 CPEB4, an RNA binding protein that mediates meiotic mRNA cytoplasmic polyadenylation and translation, is overexpressed in pancreatic ductal adenocarcinomas and glioblastomas, where it supports tumor growth, vascularization and invasion.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAWLFPAPATHNI      1 - 70
QDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDNSSENGNGKEKIRIESPVL     71 - 140
TGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPAASANNGALLFQNF    141 - 210
PHHVSPGFGGSFSPQIGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNK    211 - 280
PPSPWSSYQSPSPTPSSSWSPGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYAR    281 - 350
PSSAFAPKSWMEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINA    351 - 420
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITA    421 - 490
SFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP    491 - 560
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFS    561 - 630
NQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAA    631 - 700
IHSRAGREFHKPLVKEGGDRPRHISFRWN                                             701 - 729
//

Text Mined References (36)

PMID Year Title
26627607 2016 Sequential Functions of CPEB1 and CPEB4 Regulate Pathologic Expression of Vascular Endothelial Growth Factor and Angiogenesis in Chronic Liver Disease.
26398195 2015 Global Analysis of CPEBs Reveals Sequential and Non-Redundant Functions in Mitotic Cell Cycle.
26361147 2015 MicroRNA-203-mediated posttranscriptional deregulation of CPEB4 contributes to colorectal cancer progression.
26209100 2015 The microRNA-1246 promotes metastasis in non-small cell lung cancer by targeting cytoplasmic polyadenylation element-binding protein 4.
25081215 2014 RNA recognition and self-association of CPEB4 is mediated by its tandem RRM domains.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24045092 2013 CPEB4 is a candidate biomarker for defining metastatic cancers and directing personalized therapies.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145039 2012 MicroRNA-550a acts as a pro-metastatic gene and directly targets cytoplasmic polyadenylation element-binding protein 4 in hepatocellular carcinoma.
More...