Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Synonym

Accession Q17RM4 B7ZKV5 Q8NBJ3 Q8NBV2 Q96KA7
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MAQASRSGSLPPLVIVPPLRAQPGGTGEEQWERSRTGGLRWEVHCWPSGTSGGTPWWPTPADVSEDYEAD      1 - 70
AAAWRRGPAGGGPIPPALQRLRAVLLRLHREREQLLQARDCAYHLQSAVRLMKTLSPGSPSGGPSPLPQW     71 - 140
CRDLQLHPSQGAVLRIGPGETLEPLLLARPIGLAAQCLEAVIEMQLRALGREPASPGLSSQLAELLFALP    141 - 210
AYHTLQRKALSHVPGAARPFPTSRVLRLLTGERGCQVASRLDEALQGSALRDQLRRRCQEEGDLLPGLLG    211 - 280
LVGGVAGSASCGLGLGGAGALWSQYWTLLWAACAQSLDLNLGPWRDPRATAQQLSQALGQASLPQECEKE    281 - 350
LASLCHRLLHQSLIWSWDQGFCQALGSALGGQSSLPTSSGTAELLQQLFPPLLDALREPRLRRIFCQPAD    351 - 420
PAPVALGLCTLQTTLLWFLGRAQQYLAAWDPASFLLLIQKDLPPLLHEAEALYSLASEESLALEVEQQLG    421 - 490
LEIQKLTAQIQLLPEESLSVFSQECHKQAMQGFKLYMPRGRYWRLRLCPEPPSAPSEYAGLVVRTVLEPV    491 - 560
LQGLQGLPPQAQAPALGQALTAIVGAWLDHILTHGIRFSLQGALQLKQDFGVVRELLEEEQWSLSPDLRQ    561 - 630
TLLMLSIFQQLDGALLCLLQQPLPKSQVHRRPPCCCACQEVQTTKLPSSCLNSLESLEPPLQPGTSPAQT    631 - 700
GQLQSTLGGRGPSPEGYLVGNQQAWLALRQHQRPRWHLPFFSCLGTSPES                        701 - 750
//

Text Mined References (6)

PMID Year Title