Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.94
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
AMELOGENESIS IMPERFECTA, HYPOMATURATION TYPE, IIA4 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.2e-08
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 1.0
Disease Target Count Z-score Confidence
Amelogenesis imperfecta 29 5.046 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 1.2e-08

Synonym

Accession Q17RF5 B4DTI3 E7ETQ0 Q8TEC3
Symbols AI2A4
C4orf26

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRC      1 - 70
PFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES               71 - 130
//

Text Mined References (9)

PMID Year Title