Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.87
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Gene RIF (1)

PMID Text
22901946 Autozygosity mapping and clonal sequencing of an Omani family identified mutations in the uncharacterized gene, C4orf26, as a cause of recessive hypomineralized amelogenesis imperfecta

AA Sequence

MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRC      1 - 70
PFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES               71 - 130
//

Text Mined References (9)

PMID Year Title
27558265 2016 Amelogenesis Imperfecta: 1 Family, 2 Phenotypes, and 2 Mutated Genes.
26596502 2016 Inactivation of C4orf26 in toothless placental mammals.
25416956 2014 A proteome-scale map of the human interactome network.
22901946 2012 Mutations in C4orf26, encoding a peptide with in vitro hydroxyapatite crystal nucleation and growth activity, cause amelogenesis imperfecta.
22658654 2012 Genomic determinants of motor and cognitive outcomes in Parkinson's disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.