Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.16
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.800 0.002
ependymoma -2.200 0.000
glioblastoma -3.000 0.001
oligodendroglioma -2.100 0.000
sonic hedgehog group medulloblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -4.400 0.001
adult high grade glioma -2.400 0.007
pilocytic astrocytoma -1.800 0.004
pituitary cancer -1.500 0.000
psoriasis -1.200 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16946482 Human synaptotagmin tandem C2 domains C2A-C2B have been expressed as a glutathione-S-transferase fusion protein in Escherichia coli, purified, and crystallized and the preliminary X-ray analysis reported.

AA Sequence

MVLAMASQDVQNFFQPFSSWISRVYEALQQAGDMLSASLVNISKQDSKLSDKLDQDLDNIQIQETYFEDE      1 - 70
EQDNDWSQEDANSLFLEVDHFSCCNSDLQDSAQNSSPSLSQHAKDSCSTMSQWPNWASDDRKLPHVLSSI     71 - 140
AEEEHHLEKQRSGLQHGFDSQLPGTLETVNGKKQVNSFGDDEELSTSSDSDEEVIKQFEISVSRSQSFRS    141 - 210
VTSEKGKQTGLEQKPKFSRSLLTHGEDGTEVSACEDLDGASQRRYSENLSYGEDDHIPAHSQSPCERGDA    211 - 280
KHHGTSHQESSVVQSLRRQSTEGSLEMETAFNSRGFEDSYATDSSSMWSPEEQDRTNLQVPSGVSEPISK    281 - 350
CGDLDVIFEYRAASQKLTVTIVRAQGLPDKDRSGVNSWQVHVVLLPGKKHRGRTNIQRGPNPVFREKVTF    351 - 420
AKLEPRDVAACAVRFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVS    421 - 490
HSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRC    491 - 560
KTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKE    561 - 630
TKGQQICRWHTLLES                                                           631 - 645
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
24478790 2013 Genome wide association and linkage analyses identified three loci-4q25, 17q23.2, and 10q11.21-associated with variation in leukocyte telomere length: the Long Life Family Study.
20707712 2010 A genome-wide association study of self-rated health.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16946482 2006 Purification, crystallization and X-ray diffraction analysis of human synaptotagmin 1 C2A-C2B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15238157 2004 Synaptotagmin gene content of the sequenced genomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12801916 2003 Molecular cloning, expression, and characterization of a novel class of synaptotagmin (Syt XIV) conserved from Drosophila to humans.
More...