Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.12
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.400 6.8e-03
astrocytic glioma -2.800 2.3e-03
Astrocytoma, Pilocytic -1.800 3.9e-03
atypical teratoid / rhabdoid tumor -3.600 8.3e-05
ependymoma -2.100 3.1e-03
glioblastoma -2.000 1.2e-04
group 3 medulloblastoma -1.100 7.0e-03
medulloblastoma, large-cell -4.400 7.9e-04
oligodendroglioma -2.100 4.3e-12
pituitary cancer -1.500 3.8e-04
psoriasis -1.200 4.9e-06

Synonym

Accession Q17RD7 B4DZH2 B7ZL60 C9J8I3 Q707N2 Q7Z441 Q8IUU0 Q9BQR8
Symbols yt14r
SYT14L
syt14r
Strep14
CHR14SYT

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVLAMASQDVQNFFQPFSSWISRVYEALQQAGDMLSASLVNISKQDSKLSDKLDQDLDNIQIQETYFEDE      1 - 70
EQDNDWSQEDANSLFLEVDHFSCCNSDLQDSAQNSSPSLSQHAKDSCSTMSQWPNWASDDRKLPHVLSSI     71 - 140
AEEEHHLEKQRSGLQHGFDSQLPGTLETVNGKKQVNSFGDDEELSTSSDSDEEVIKQFEISVSRSQSFRS    141 - 210
VTSEKGKQTGLEQKPKFSRSLLTHGEDGTEVSACEDLDGASQRRYSENLSYGEDDHIPAHSQSPCERGDA    211 - 280
KHHGTSHQESSVVQSLRRQSTEGSLEMETAFNSRGFEDSYATDSSSMWSPEEQDRTNLQVPSGVSEPISK    281 - 350
CGDLDVIFEYRAASQKLTVTIVRAQGLPDKDRSGVNSWQVHVVLLPGKKHRGRTNIQRGPNPVFREKVTF    351 - 420
AKLEPRDVAACAVRFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVS    421 - 490
HSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRC    491 - 560
KTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKE    561 - 630
TKGQQICRWHTLLES                                                           631 - 645
//

Text Mined References (14)

PMID Year Title