Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 1.76892282057701E-13
psoriasis 6685 9.52931844896091E-10
Breast cancer 3099 4.02945048745536E-9
atypical teratoid / rhabdoid tumor 4369 1.58588290591516E-4
ovarian cancer 8492 3.97808909644017E-4
Atopic dermatitis 944 0.0013381691128839
chronic rhinosinusitis 512 0.00603546332423659
Rheumatoid Arthritis 1171 0.0458254802253802

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.046
atypical teratoid / rhabdoid tumor -1.400 0.000
Atopic dermatitis -1.100 0.001
lung adenocarcinoma -1.300 0.000
psoriasis -1.200 0.000
Breast cancer -1.100 0.000
ovarian cancer -1.500 0.000
chronic rhinosinusitis -1.088 0.006

Synonym

Accession Q17RB8 B4DM29 B4DU84 Q8TEA0 Q9BSV1
Symbols RNF191

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWELLLRRGELLALGGHLKGALEA      1 - 70
FAAALRRGAPARPECLGALVDCLVFNYRLRHGLGWSAAPVAGADGGAGGLLRCLGCRGFLSEPVTVPCGH     71 - 140
SYCRRCLRRELRARCRLCRDRLPPATASATDAEGTAPRPPPLAAAIAASDFRTSVVLNHLAEKWFPGQRE    141 - 210
RARAAGRLGELLHQGRYREALAAACEALRAEPSDLIVKIYRAESYAGLQEFKAAIEDLNAVLFQLPDWPE    211 - 280
VYFRKGKVLCDAGFLGDALQLFLQCLALDEDFAPAKLQVQKILCDLLLPENLKEGLKESSWSSLPCTKNR    281 - 350
PFDFHSVMEESQSLNEPSPKQSEEIPEVTSEPVKGSLNRAQSAQSINSTEMPAREDCLKRVSSEPVLSVQ    351 - 420
EKGVLLKRKLSLLEQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECSLCMRLFFEPV    421 - 490
TTPCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKKIYDEETAE    491 - 560
LSHLTKNVPIFVCTMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVSDTQNSFADYGCMLQIRNVH    561 - 630
FLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKVENEDEIKNLRELHDLVYSQACSWFQNLRD    631 - 700
RFRSQILQHFGSMPEREENLQAAPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRD    701 - 770
QSK                                                                       771 - 773
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18253036 2007 Comparative FISH-mapping of twelve loci in river buffalo and sheep chromosomes: comparison with HSA8p and HSA4q.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.