Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.100 1.3e-03
atypical teratoid / rhabdoid tumor -1.400 1.6e-04
Breast cancer -1.100 4.0e-09
chronic rhinosinusitis -1.088 6.0e-03
lung adenocarcinoma -1.200 4.8e-11
ovarian cancer -1.500 4.0e-04
psoriasis -1.200 9.5e-10
Rheumatoid arthritis 1.200 4.6e-02

AA Sequence

MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWELLLRRGELLALGGHLKGALEA      1 - 70
FAAALRRGAPARPECLGALVDCLVFNYRLRHGLGWSAAPVAGADGGAGGLLRCLGCRGFLSEPVTVPCGH     71 - 140
SYCRRCLRRELRARCRLCRDRLPPATASATDAEGTAPRPPPLAAAIAASDFRTSVVLNHLAEKWFPGQRE    141 - 210
RARAAGRLGELLHQGRYREALAAACEALRAEPSDLIVKIYRAESYAGLQEFKAAIEDLNAVLFQLPDWPE    211 - 280
VYFRKGKVLCDAGFLGDALQLFLQCLALDEDFAPAKLQVQKILCDLLLPENLKEGLKESSWSSLPCTKNR    281 - 350
PFDFHSVMEESQSLNEPSPKQSEEIPEVTSEPVKGSLNRAQSAQSINSTEMPAREDCLKRVSSEPVLSVQ    351 - 420
EKGVLLKRKLSLLEQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECSLCMRLFFEPV    421 - 490
TTPCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKKIYDEETAE    491 - 560
LSHLTKNVPIFVCTMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVSDTQNSFADYGCMLQIRNVH    561 - 630
FLPDGRSVVDTVGGKRFRVLKRGMKDGYCTADIEYLEDVKVENEDEIKNLRELHDLVYSQACSWFQNLRD    631 - 700
RFRSQILQHFGSMPEREENLQAAPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRD    701 - 770
QSK                                                                       771 - 773
//

Text Mined References (9)

PMID Year Title