Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.0e-29
osteosarcoma 7950 4.8e-08

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.966 4.8e-08
psoriasis -1.300 1.0e-29

Synonym

Accession Q17RA5
Symbols C21orf49

 Compartment GO Term (1)

AA Sequence

MHHVRQLMMPICPMALNSTTSSSTTFGAFRIMTLNVEEWATAWKVLILLEAAVEEEKRSEEKRILVCGTC      1 - 70
GTRSSQKNL                                                                  71 - 79
//

Text Mined References (7)

PMID Year Title