Property Summary

NCBI Gene PubMed Count 12
Grant Count 7
R01 Count 5
Funding $716,283.35
PubMed Score 31.56
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
chronic lymphosyte leukemia 2.600 0.000
astrocytic glioma -2.600 0.001
ependymoma -3.500 0.000
oligodendroglioma -2.200 0.000
glioblastoma -4.300 0.000
sonic hedgehog group medulloblastoma -3.000 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -2.900 0.000
non-small cell lung cancer -2.082 0.000
lung cancer -2.300 0.000
colon cancer -1.400 0.004
active Crohn's disease -1.078 0.015
ulcerative colitis -1.900 0.000
lung adenocarcinoma -1.900 0.000
adult high grade glioma -4.200 0.000
pilocytic astrocytoma -3.100 0.000
ovarian cancer -3.800 0.000

Gene RIF (3)

PMID Text
21107268 Besides the already known chromosome 6 associations, the analysis of low-frequency single nucleotide polymorphisms brought up a new association in the RICH2 gene for progression to AIDS.
19273615 Knocking down expression of RICH 2 causes loss of the apical actin network and apical microvilli, an increase in actin bundles at the basal surface, and a reduction in cell height. (RICH 2 protein)
11431473 Demonstrates that the RhoGAP domains of RICH-1 and RICH-2 can catalyze GTP hydrolysis of both Rac1 and Cdc42, but not of RhoA.

AA Sequence

MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGAEADKRSKKLP      1 - 70
LTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRK     71 - 140
HLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAANRVEICRDQLSADMYSFVAKEID    141 - 210
YANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLL    211 - 280
ECGMQEEGLFRVAPSASKLKKLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQA    281 - 350
SNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT    351 - 420
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPADRRQPEQARR    421 - 490
PLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTNWVARRGSSAGRKVSCAPPSMQPPAPPAELAAPLPSPL    491 - 560
PEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSAQKGSPGSSQGTACAGTQPGAQPGAQPGASP    561 - 630
SPSQPPADQSPHTLRKVSKKLAPIPPKVPFGQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSL    631 - 700
ASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESM    701 - 770
STDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSEEESESTAL                          771 - 818
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22750946 2012 External push and internal pull forces recruit curvature-sensing N-BAR domain proteins to the plasma membrane.
22566634 2012 The genetic architecture of economic and political preferences.
21107268 2011 Screening low-frequency SNPS from genome-wide association study reveals a new risk allele for progression to AIDS.
19273615 2009 A CD317/tetherin-RICH2 complex plays a critical role in the organization of the subapical actin cytoskeleton in polarized epithelial cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...