Property Summary

NCBI Gene PubMed Count 13
PubMed Score 34.40
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.078 1.5e-02
active ulcerative colitis -1.502 2.4e-03
adult high grade glioma -4.200 1.9e-08
astrocytic glioma -2.600 1.2e-03
Astrocytoma, Pilocytic -3.200 3.1e-12
atypical teratoid / rhabdoid tumor -3.200 1.6e-10
Chronic Lymphocytic Leukemia 2.026 1.1e-03
colon cancer -1.400 3.6e-03
ependymoma -2.300 7.8e-04
glioblastoma -3.700 7.1e-12
group 3 medulloblastoma -1.200 6.0e-03
lung adenocarcinoma -1.700 2.7e-17
lung cancer -1.400 7.7e-04
medulloblastoma, large-cell -3.400 1.9e-08
non-small cell lung cancer -2.082 1.4e-27
oligodendroglioma -1.700 1.1e-02
ovarian cancer -3.800 1.9e-15
primitive neuroectodermal tumor -2.900 8.9e-07

Protein-protein Interaction (9)

Gene RIF (4)

AA Sequence

MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGAEADKRSKKLP      1 - 70
LTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRK     71 - 140
HLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAANRVEICRDQLSADMYSFVAKEID    141 - 210
YANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLL    211 - 280
ECGMQEEGLFRVAPSASKLKKLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQA    281 - 350
SNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT    351 - 420
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPADRRQPEQARR    421 - 490
PLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTNWVARRGSSAGRKVSCAPPSMQPPAPPAELAAPLPSPL    491 - 560
PEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSAQKGSPGSSQGTACAGTQPGAQPGAQPGASP    561 - 630
SPSQPPADQSPHTLRKVSKKLAPIPPKVPFGQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSL    631 - 700
ASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESM    701 - 770
STDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSEEESESTAL                          771 - 818
//

Text Mined References (15)

PMID Year Title