Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.62
PubTator Score 17.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.5e-02
Astrocytoma, Pilocytic -1.300 1.1e-04
atypical teratoid / rhabdoid tumor -1.500 6.2e-07
ependymoma -1.400 9.3e-12
glioblastoma -1.300 4.1e-07
group 3 medulloblastoma -1.300 3.6e-02
primitive neuroectodermal tumor -1.500 1.2e-03

Gene RIF (7)

AA Sequence

MYLETRRAIFVFWIFLQVQGTKDISINIYHSETKDIDNPPRNETTESTEKMYKMSTMRRIFDLAKHRTKR      1 - 70
SAFFPTGVKVCPQESMKQILDSLQAYYRLRVCQEAVWEAYRIFLDRIPDTGEYQDWVSICQQETFCLFDI     71 - 140
GKNFSNSQEHLDLLQQRIKQRSFPDRKDEISAEKTLGEPGETIVISTDVANVSLGPFPLTPDDTLLNEIL    141 - 210
DNTLNDTKMPTTERETEFAVLEEQRVELSVSLVNQKFKAELADSQSPYYQELAGKSQLQMQKIFKKLPGF    211 - 280
KKIHVLGFRPKKEKDGSSSTEMQLTAIFKRHSAEAKSPASDLLSFDSNKIESEEVYHGTMEEDKQPEIYL    281 - 350
TATDLKRLISKALEEEQSLDVGTIQFTDEIAGSLPAFGPDTQSELPTSFAVITEDATLSPELPPVEPQLE    351 - 420
TVDGAEHGLPDTSWSPPAMASTSLSEAPPFFMASSIFSLTDQGTTDTMATDQTMLVPGLTIPTSDYSAIS    421 - 490
QLALGISHPPASSDDSRSSAGGEDMVRHLDEMDLSDTPAPSEVPELSEYVSVPDHFLEDTTPVSALQYIT    491 - 560
TSSMTIAPKGRELVVFFSLRVANMAFSNDLFNKSSLEYRALEQQFTQLLVPYLRSNLTGFKQLEILNFRN    561 - 630
GSVIVNSKMKFAKSVPYNLTKAVHGVLEDFRSAAAQQLHLEIDSYSLNIEPADQADPCKFLACGEFAQCV    631 - 700
KNERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQN    701 - 770
NKVISKRNSELLTVEYEEFNHQDWEGN                                               771 - 797
//

Text Mined References (19)

PMID Year Title