Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.07
PubTator Score 1.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.951 2.0

Expression

AA Sequence

MPPMLWLLLHFAAPALGFYFSISCPSGKQCQQALLSGNDILLYCNSSGAHWYYLFTQGKKGRLTSLTNIS      1 - 70
NMEIMPEGSLLIKDPLPSQTGLYHCWNKNGRQVVQYEIDFQDVTTLHITHKDLGQRPLQNETLHLGSKQL     71 - 140
IFTWWEPWQDCNRCEEPGECKRLGYRYIEEPLEEAMPCWLYLGEVLVWSSRLRPELQVEACHVQCTNNTQ    141 - 210
LRVDYVIFDNFRLDEKTEFVWLDCPLGSMYRPVNWRANDTPLTWESQLSGQDFTTFLDPSTGGRQLQVFQ    211 - 280
PAVYKCFVQQELVAQFKPAASLETLEAQWRENDAQWREARKALRGRADSVLKGLKLVLLVVTVLALLGAL    281 - 350
LKCIHPSPGRRSTQVLVVK                                                       351 - 369
//

Text Mined References (3)

PMID Year Title