Property Summary

NCBI Gene PubMed Count 15
PubMed Score 29.36
PubTator Score 14.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytoma -2.600 0.002
ependymoma -2.700 0.019
esophageal adenocarcinoma -2.600 0.021
psoriasis -1.500 0.000
glioblastoma -2.700 0.006
oligodendroglioma -1.100 0.000
medulloblastoma -2.700 0.000
cystic fibrosis -2.528 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -2.400 0.001
adrenocortical carcinoma -1.655 0.006
pancreatic ductal adenocarcinoma liver m... -1.994 0.017
non-small cell lung cancer 1.192 0.000
intraductal papillary-mucinous adenoma (... -2.000 0.003
intraductal papillary-mucinous carcinoma... -3.300 0.014
intraductal papillary-mucinous neoplasm ... -2.700 0.023
lung cancer 1.700 0.033
colon cancer 1.400 0.002
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.800 0.000
invasive ductal carcinoma -1.463 0.014
Endometriosis -1.023 0.025
spina bifida -1.648 0.037
Breast cancer -1.100 0.007
gastric carcinoma -2.800 0.039
ovarian cancer -2.900 0.000
Down syndrome 1.700 0.001
pancreatic cancer -1.900 0.007

Gene RIF (3)

PMID Text
16620967 The results indicate that tumor protein D52-like 1 genes are not ubiquitously expressed in leukemic bone marrow in children, and that RNA sample parameters may influence measures of gene expression more than commonly appreciated.
14761963 a member of the tumor protein D52 family involved in cell proliferation and calcium signaling, up-regulates the ASK1-induced apoptosis [D53L1]
12963375 These results identify 14-3-3 proteins as partners for hD53, and alternative splicing as a mechanism for regulating 14-3-3 binding.

AA Sequence

MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQK      1 - 70
LGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPA     71 - 140
MRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC          141 - 204
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16631610 2006 A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins.
16620967 2006 Expression of tumor protein D52-like genes in childhood leukemia at diagnosis: clinical and sample considerations.
More...