Property Summary

NCBI Gene PubMed Count 15
PubMed Score 29.73
PubTator Score 14.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma -1.293 9.8e-03
adult high grade glioma -1.200 2.4e-02
astrocytic glioma -2.300 7.1e-03
Astrocytoma, Pilocytic -1.800 6.7e-05
Breast cancer -1.100 7.1e-03
colon cancer 1.300 7.8e-04
cystic fibrosis -2.528 1.9e-06
Down syndrome 1.700 5.3e-04
Endometriosis -1.023 2.5e-02
ependymoma -2.600 1.1e-02
esophageal adenocarcinoma -2.100 2.3e-02
gastric carcinoma -2.400 3.8e-02
glioblastoma -1.600 1.9e-04
group 3 medulloblastoma -2.500 6.4e-04
intraductal papillary-mucinous adenoma (... -2.000 3.1e-03
intraductal papillary-mucinous carcinoma... -3.300 1.4e-02
intraductal papillary-mucinous neoplasm ... -2.700 2.3e-02
invasive ductal carcinoma -1.463 1.4e-02
lung cancer 1.700 3.3e-02
malignant mesothelioma -1.100 1.8e-05
medulloblastoma, large-cell -3.000 1.7e-04
non-small cell lung cancer 1.094 7.0e-06
oligodendroglioma -1.100 1.1e-05
ovarian cancer -2.900 3.2e-08
pancreatic cancer -1.900 6.8e-03
pancreatic ductal adenocarcinoma liver m... -1.994 1.7e-02
primitive neuroectodermal tumor -2.400 8.0e-04
psoriasis -1.500 2.9e-04
spina bifida -1.648 3.7e-02

Gene RIF (3)

AA Sequence

MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQK      1 - 70
LGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPA     71 - 140
MRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC          141 - 204
//

Text Mined References (23)

PMID Year Title