Property Summary

Ligand Count 1
NCBI Gene PubMed Count 114
PubMed Score 208.24
PubTator Score 747.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.403 2.4e-04
Barrett's esophagus 1.100 2.5e-02
esophageal adenocarcinoma 1.300 1.8e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.7e-02
lung cancer 2.200 2.9e-05
ovarian cancer -2.100 1.6e-07
tuberculosis -1.500 4.0e-07

Gene RIF (94)

AA Sequence

MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQAYIDGHSVVI      1 - 70
FSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAY     71 - 140
QEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV    141 - 210
NVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENA    211 - 280
YGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASY    281 - 350
VALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV    351 - 420
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV    421 - 490
ELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLE    491 - 560
WTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFT    561 - 630
TLSVTKRSGASILQAGCUG                                                       631 - 649
//

Text Mined References (122)

PMID Year Title