Property Summary

NCBI Gene PubMed Count 97
Grant Count 34
R01 Count 5
Funding $2,529,952.97
PubMed Score 186.72
PubTator Score 747.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus 1.100 0.025
esophageal adenocarcinoma 1.300 0.018
acute quadriplegic myopathy 1.403 0.000
tuberculosis -1.500 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.017
lung cancer 2.300 0.000
ovarian cancer -2.100 0.000

 GWAS Trait (1)

Gene RIF (76)

PMID Text
27002142 Under the conditions of inhibition of TrxRs in cells, Parthenolide (PTL) does not cause significant alteration of cellular thiol homeostasis, supporting selective target of TrxRs by PTL. Importantly, overexpression of functional TrxR1 or Trx1 confers protection, whereas knockdown of the enzymes sensitizes cells to PTL treatment.
26871773 Rheumatoid arthritis patients with high disease activity had significantly elevated TrxR levels in plasma and synovial fluid than did those with low disease activity.
26464515 TXNRD1_v1 and TXNRD1_v2 have distinct roles in differentiation, possibly by altering the expression of the genes associated with differentiation, and further emphasize the importance in distinguishing each unique action of different TrxR1 splice forms
26184858 Tissue microarrays containing human nevi and melanomas were used to evaluate levels of the antioxidant protein thioredoxin reductase 1 (TR1), which was found to increase as a function of disease progression.
26117319 TRX-1/PRX-1 levels are associated with NADPH oxidase-activity in vivo and in vitro in atherosclerosis.
26064428 The association of TXNRD1 variability was found with physical performance, with three variants (rs4445711, rs1128446, and rs11111979) associated with physical functioning after 85 years of age.
25592259 It seems to be involved in the malignant progression of meningiomas.
25576832 Se/S-palmitoylation acts as an important modulator of TrxR1/hTrx1 activities
25495870 Thioredoxin reductase activity may be more important than GSH level in protecting human lens epithelial cells against UVA light.
25391969 Expression of TrxR1 correlated highly with both the astrocytoma grade and proliferative index
More...

AA Sequence

MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQAYIDGHSVVI      1 - 70
FSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAY     71 - 140
QEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV    141 - 210
NVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENA    211 - 280
YGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASY    281 - 350
VALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV    351 - 420
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV    421 - 490
ELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLE    491 - 560
WTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFT    561 - 630
TLSVTKRSGASILQAGCUG                                                       631 - 649
//

Text Mined References (105)

PMID Year Title
27002142 2016 Targeting Thioredoxin Reductase by Parthenolide Contributes to Inducing Apoptosis of HeLa Cells.
26871773 2016 Plasma and Synovial Fluid TrxR Levels are Correlated With Disease Risk and Severity in Patients With Rheumatoid Arthritis.
26464515 2015 The expression and activity of thioredoxin reductase 1 splice variants v1 and v2 regulate the expression of genes associated with differentiation and adhesion.
26184858 2015 The role of thioredoxin reductase 1 in melanoma metabolism and metastasis.
26117319 2015 Thioredoxin-1/peroxiredoxin-1 as sensors of oxidative stress mediated by NADPH oxidase activity in atherosclerosis.
26064428 2015 Antioxidants and Quality of Aging: Further Evidences for a Major Role of TXNRD1 Gene Variability on Physical Performance at Old Age.
25592259 2015 High thioredoxin reductase 1 expression in meningiomas undergoing malignant progression.
25576832 2015 Mechanistic insights into the inhibitory effects of palmitoylation on cytosolic thioredoxin reductase and thioredoxin.
25495870 Thioredoxin reductase activity may be more important than GSH level in protecting human lens epithelial cells against UVA light.
25391969 2015 Tissue thioredoxin reductase-1 expression in astrocytomas of different grades.
More...