Property Summary

NCBI Gene PubMed Count 20
PubMed Score 38.33
PubTator Score 86.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.30254933210058E-42
non-small cell lung cancer 2798 5.09723781557152E-12
lung adenocarcinoma 2714 1.81936225118896E-10
cystic fibrosis 1670 3.39823303439077E-7
ependymoma 2514 1.02045442431542E-6
Breast cancer 3099 2.53515404037189E-6
atypical teratoid/rhabdoid tumor 1095 6.23751160200638E-5
pancreatic cancer 2300 1.9240218712373E-4
glioblastoma multiforme 347 8.53725602174629E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.96911950639038E-4
Down syndrome 548 0.00316604541119291
ovarian cancer 8492 0.00332054343617818
subependymal giant cell astrocytoma 2287 0.00367396061884053
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00455799395231804
group 3 medulloblastoma 2254 0.00615240018316411
ulcerative colitis 2087 0.00736652542454239
pilocytic astrocytoma 3086 0.0163953949310943
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0173039141275104
progressive supranuclear palsy 674 0.042112534493498
Disease Target Count Z-score Confidence
substance-induced psychosis 7 3.467 1.7
Krabbe disease 11 3.158 1.6

Expression

Synonym

Accession Q16880 B3KXU7 O00196
Symbols CGT
UGT4

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 CSPA Cell Line (4)

Gene RIF (14)

PMID Text
25519837 A new role was identified for UGT8 as a modulator of bile acid homeostasis.
24821492 Our study suggests that CGT expression is controlled by balanced expression of the negative modulator OLIG2 and positive regulator Nkx2.2, providing new insights into how expression of GalCer is tightly regulated in cell-type- and stage-specific manners.
24391908 High expression of UGT8 accompanied by accumulation of GalCer in MDA-MB-231 cells is associated with a much higher proliferative index and a lower number of apoptotic cells in comparison to the MDA/LUC-shUGT8 cells.
23118445 Comprehensive genomic analyses associate UGT8 variants with musical ability in a Mongolian population.
20648017 UGT8 is a significant index of tumour aggressiveness and is seen in lung metastases of breast cancer.
20332099 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19125296 Gene expression of galactosyl ceramide synthase associated with poor pathohistological grading in breast cancer
16125333 We postulate that molecular link between defective GALT enzyme, which result in classic galactosemia and the cerebroside galactosyl transferase, responsible for galactosylation of cerebrosides, is dependent on concentrations of UDP-galactose.
More...

AA Sequence

MKSYTPYFILLWSAVGIAKAAKIIIVPPIMFESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSL      1 - 70
QRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPN     71 - 140
DMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVYLISRLGVSFL    141 - 210
VLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWV    211 - 280
NGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHS    281 - 350
KIKAFLSHGGLNSIFETIYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNP    351 - 420
SYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFVLLLGAALLYF    421 - 490
LLSWVTKFIYRKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKVK                       491 - 541
//

Text Mined References (22)

PMID Year Title
25519837 2015 A novel function for UDP glycosyltransferase 8: galactosidation of bile acids.
24821492 2014 Ceramide galactosyltransferase expression is regulated positively by Nkx2.2 and negatively by OLIG2.
24391908 2013 Galactosylceramide affects tumorigenic and metastatic properties of breast cancer cells as an anti-apoptotic molecule.
23118445 2012 Comprehensive genomic analyses associate UGT8 variants with musical ability in a Mongolian population.
20648017 2010 Ceramide galactosyltransferase (UGT8) is a molecular marker of breast cancer malignancy and lung metastases.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19125296 2009 Gene expression of ceramide kinase, galactosyl ceramide synthase and ganglioside GD3 synthase is associated with prognosis in breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...