Property Summary

NCBI Gene PubMed Count 22
PubMed Score 39.56
PubTator Score 86.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.7e-02
atypical teratoid / rhabdoid tumor -1.200 2.0e-02
Breast cancer -2.400 2.5e-06
cystic fibrosis 1.062 4.0e-05
Down syndrome 1.700 3.2e-03
ependymoma -1.900 2.2e-06
glioblastoma multiforme -1.200 1.2e-04
group 3 medulloblastoma -2.300 2.0e-02
intraductal papillary-mucinous adenoma (... 1.900 7.6e-04
intraductal papillary-mucinous carcinoma... 1.300 1.9e-02
intraductal papillary-mucinous neoplasm ... 3.000 4.6e-03
lung adenocarcinoma 1.400 1.8e-10
lung carcinoma 2.200 3.3e-42
non-small cell lung cancer 1.582 2.5e-11
ovarian cancer 1.700 3.3e-03
pancreatic cancer 1.500 1.9e-04
progressive supranuclear palsy -1.300 4.2e-02
subependymal giant cell astrocytoma -3.901 2.5e-03
ulcerative colitis -1.469 7.4e-03

 CSPA Cell Line (4)

Gene RIF (16)

AA Sequence

MKSYTPYFILLWSAVGIAKAAKIIIVPPIMFESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSL      1 - 70
QRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPN     71 - 140
DMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVYLISRLGVSFL    141 - 210
VLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWV    211 - 280
NGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHS    281 - 350
KIKAFLSHGGLNSIFETIYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNP    351 - 420
SYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFVLLLGAALLYF    421 - 490
LLSWVTKFIYRKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKVK                       491 - 541
//

Text Mined References (24)

PMID Year Title