Property Summary

NCBI Gene PubMed Count 33
PubMed Score 35.34
PubTator Score 172.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Atopic dermatitis -1.600 2.0e-03
atypical teratoid/rhabdoid tumor 1.100 5.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.017 9.9e-03
Breast cancer -1.900 1.3e-07
breast carcinoma -2.100 6.1e-04
cystic fibrosis 2.180 1.5e-06
ductal carcinoma in situ -3.000 1.2e-04
fibroadenoma -2.500 6.7e-03
interstitial cystitis -1.400 1.0e-02
intraductal papillary-mucinous adenoma (... -2.500 6.9e-04
intraductal papillary-mucinous carcinoma... -2.700 6.0e-04
intraductal papillary-mucinous neoplasm ... -2.800 5.6e-03
invasive ductal carcinoma -1.096 2.7e-03
lung adenocarcinoma -1.200 5.2e-12
lung cancer -2.600 5.2e-06
medulloblastoma, large-cell -1.800 1.5e-04
non-small cell lung cancer -2.775 1.4e-25
ovarian cancer -1.700 1.2e-05
pancreatic ductal adenocarcinoma liver m... -2.347 1.7e-02
Pick disease -1.100 5.1e-04
psoriasis -1.600 4.0e-06

Protein-protein Interaction (7)

Gene RIF (20)

AA Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF      1 - 70
NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLH     71 - 140
RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN              141 - 200
//

Text Mined References (38)

PMID Year Title