Property Summary

NCBI Gene PubMed Count 29
Grant Count 9
R01 Count 9
Funding $677,679.25
PubMed Score 31.38
PubTator Score 172.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
26785325 methylation of the CDO1 gene promoter could be strong prognostic indicator in primary BC without preoperative treatment.
25904753 CDO1 promoter methylation may not substitute common prognostic makers to predict ccRCC survival, but offers additional, relevant prognostic information, indicating that it might be a novel molecular marker to determine ccRCC prognosis
25903467 Decreased expression of CDO1 is associated with esophageal squamous cell carcinoma.
25261132 A structural role of the Cys-Tyr cofactor coordinates the ferrous iron in the active site of CDO1.
24948044 A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors.
24646840 methylation status of serum CDO1 gene promoter may be helpful in the diagnosis of hepatocellular carcinoma (HCC) and the estimation of the HCC stages.
24553827 TGF-b1 suppressed Cdo1 gene transcription through the MEK/ERK pathway.
24486589 we define a three-gene panel, CDO1, HOXA9, and TAC1, which we subsequently validate in two independent cohorts of primary NSCLC samples
23630167 Our study shows the importance of CDO1 inactivation in breast cancer and its clinical potential as a biomarker and therapeutic target to overcome resistance to anthracyclines.
23028699 CDO1 as a novel tumor suppressor gene and a potentially valuable molecular marker for human cancer
More...

AA Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF      1 - 70
NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLH     71 - 140
RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN              141 - 200
//

Text Mined References (34)

PMID Year Title
26785325 2016 Prognostic Significance of Promoter DNA Hypermethylation of cysteine dioxygenase 1 (CDO1) Gene in Primary Breast Cancer.
25904753 2015 Promoter Methylation of CDO1 Identifies Clear-Cell Renal Cell Cancer Patients with Poor Survival Outcome.
25903467 2015 Epigenetic regulation of the novel tumor suppressor cysteine dioxygenase 1 in esophageal squamous cell carcinoma.
25411281 2014 Meta-analysis of genome-wide association studies for circulating phylloquinone concentrations.
25261132 2015 Involvement of the Cys-Tyr cofactor on iron binding in the active site of human cysteine dioxygenase.
24948044 2015 The novel colorectal cancer biomarkers CDO1, ZSCAN18 and ZNF331 are frequently methylated across gastrointestinal cancers.
24646840 2014 Methylated cysteine dioxygenase-1 gene promoter in the serum is a potential biomarker for hepatitis B virus-related hepatocellular carcinoma.
24553827 2014 Branched-chain amino acids inhibit the TGF-beta-induced down-regulation of taurine biosynthetic enzyme cysteine dioxygenase in HepG2 cells.
24486589 2014 Functional identification of cancer-specific methylation of CDO1, HOXA9, and TAC1 for the diagnosis of lung cancer.
23630167 2013 Frequent inactivation of cysteine dioxygenase type 1 contributes to survival of breast cancer cells and resistance to anthracyclines.
More...