Property Summary

NCBI Gene PubMed Count 29
PubMed Score 31.38
PubTator Score 172.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.38474461838566E-25
lung adenocarcinoma 2714 5.84929665052886E-20
cystic fibrosis 1670 1.50630897202888E-6
psoriasis 6685 3.98005193484279E-6
lung cancer 4473 5.15232303993222E-6
ovarian cancer 8492 1.22879323921481E-5
non-inflammatory breast cancer 208 6.61642392044632E-5
invasive ductal carcinoma 2950 8.37242124481417E-5
ductal carcinoma in situ 1745 1.18202209106729E-4
medulloblastoma, large-cell 6234 1.47604665329611E-4
Pick disease 1893 5.1156915592654E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.95574867690739E-4
breast carcinoma 1614 6.08447791224827E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.93303662804748E-4
Atopic dermatitis 944 0.00198407729244659
atypical teratoid/rhabdoid tumor 1095 0.00548474280912245
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00556689516948272
fibroadenoma 557 0.00670845563628944
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00994173281204808
interstitial cystitis 2299 0.0100881159685531
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0168876949853238

Expression

Synonym

Accession Q16878 B2RAK4 P78513 Q6FHZ8 Q8TB64
Symbols CDO-I

Gene

PDB

2IC1  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (16)

PMID Text
26785325 methylation of the CDO1 gene promoter could be strong prognostic indicator in primary BC without preoperative treatment.
25904753 CDO1 promoter methylation may not substitute common prognostic makers to predict ccRCC survival, but offers additional, relevant prognostic information, indicating that it might be a novel molecular marker to determine ccRCC prognosis
25903467 Decreased expression of CDO1 is associated with esophageal squamous cell carcinoma.
25261132 A structural role of the Cys-Tyr cofactor coordinates the ferrous iron in the active site of CDO1.
24948044 A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors.
24646840 methylation status of serum CDO1 gene promoter may be helpful in the diagnosis of hepatocellular carcinoma (HCC) and the estimation of the HCC stages.
24553827 TGF-b1 suppressed Cdo1 gene transcription through the MEK/ERK pathway.
24486589 we define a three-gene panel, CDO1, HOXA9, and TAC1, which we subsequently validate in two independent cohorts of primary NSCLC samples
23630167 Our study shows the importance of CDO1 inactivation in breast cancer and its clinical potential as a biomarker and therapeutic target to overcome resistance to anthracyclines.
23028699 CDO1 as a novel tumor suppressor gene and a potentially valuable molecular marker for human cancer
More...

AA Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF      1 - 70
NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLH     71 - 140
RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN              141 - 200
//

Text Mined References (34)

PMID Year Title
26785325 2016 Prognostic Significance of Promoter DNA Hypermethylation of cysteine dioxygenase 1 (CDO1) Gene in Primary Breast Cancer.
25904753 2015 Promoter Methylation of CDO1 Identifies Clear-Cell Renal Cell Cancer Patients with Poor Survival Outcome.
25903467 2015 Epigenetic regulation of the novel tumor suppressor cysteine dioxygenase 1 in esophageal squamous cell carcinoma.
25411281 2014 Meta-analysis of genome-wide association studies for circulating phylloquinone concentrations.
25261132 2015 Involvement of the Cys-Tyr cofactor on iron binding in the active site of human cysteine dioxygenase.
24948044 2015 The novel colorectal cancer biomarkers CDO1, ZSCAN18 and ZNF331 are frequently methylated across gastrointestinal cancers.
24646840 2014 Methylated cysteine dioxygenase-1 gene promoter in the serum is a potential biomarker for hepatitis B virus-related hepatocellular carcinoma.
24553827 2014 Branched-chain amino acids inhibit the TGF-beta-induced down-regulation of taurine biosynthetic enzyme cysteine dioxygenase in HepG2 cells.
24486589 2014 Functional identification of cancer-specific methylation of CDO1, HOXA9, and TAC1 for the diagnosis of lung cancer.
23630167 2013 Frequent inactivation of cysteine dioxygenase type 1 contributes to survival of breast cancer cells and resistance to anthracyclines.
More...