Property Summary

NCBI Gene PubMed Count 25
Grant Count 10
R01 Count 10
Funding $269,316.38
PubMed Score 18.74
PubTator Score 20.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.105 0.001
adrenocortical carcinoma 1.689 0.007
intraductal papillary-mucinous adenoma (... -1.500 0.004

Gene RIF (14)

PMID Text
27491149 The expression of PFKFB3, PFKFB4, NAMPT, and TSPAN13 is strongly up-regulated in pediatric glioma.
26221874 Inhibition of PFKFB4 suppresses glycolysis and proliferation of multiple human cancer cell lines.
25772235 PFKFB4 suppresses oxidative stress and p62 accumulation, without which autophagy is stimulated likely as a ROS detoxification response.
25115398 Data indicate that the PFKFB4 expressed in multiple transformed cells and tumors functions to synthesize F2,6BP.
22892400 PFKFB4 and HO-2 are expressed in a coordinated manner to maintain glucose homeostasis.
22811469 Data suggest that molecular mechanism by which dihydrotestosterone induces Pfkfb4 (and thus glycolysis) during spermatogenesis involves stimulation of Sertoli cells to secrete FGF-2 (fibroblast growth factor 2); study uses recombinant human Pfkfb4.
22576210 we found that the glycolytic enzyme PFKFB4 is essential for prostate cancer cell survival by maintaining the balance between the use of glucose for energy generation and the synthesis of antioxidants.
22056879 an essential role of PFKFB4 in the maintenance of brain cancer stem-like cells
21640852 Sulforaphane is a potent inducer of apoptosis in hepatocellular carcinoma cells via PFKFB4-inhibition pathways.
21396842 PFKFB4 has an important role in the progression of non-muscle-invasive bladder cancer (
More...

AA Sequence

MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLTRYLNWIGVPT      1 - 70
REFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEGGHVAVFDATNTTRERRAT     71 - 140
IFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLD    141 - 210
RDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGRE    211 - 280
FAKSLAQFISDQNIKDLKVWTSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFAL    281 - 350
RDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV    351 - 420
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ                         421 - 469
//

Text Mined References (27)

PMID Year Title
27491149 [EXPRESSION OF PFKFB, HK2, NAMPT, TSPAN13 AND HSPB8 GENES IN PEDIATRIC GLIOMA].
26221874 2015 Targeting the sugar metabolism of tumors with a first-in-class 6-phosphofructo-2-kinase (PFKFB4) inhibitor.
25772235 2015 Identification of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase as a novel autophagy regulator by high content shRNA screening.
25115398 2014 Fructose-2,6-bisphosphate synthesis by 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 (PFKFB4) is required for the glycolytic response to hypoxia and tumor growth.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22892400 2012 Coordinated expression of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 and heme oxygenase 2: evidence for a regulatory link between glycolysis and heme catabolism.
22811469 2012 Sertoli-secreted FGF-2 induces PFKFB4 isozyme expression in mouse spermatogenic cells by activation of the MEK/ERK/CREB pathway.
22576210 2012 Functional metabolic screen identifies 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 as an important regulator of prostate cancer cell survival.
22056879 2012 RNAi screening in glioma stem-like cells identifies PFKFB4 as a key molecule important for cancer cell survival.
More...